SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012196 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012196
Domain Number 1 Region: 5-153
Classification Level Classification E-value
Superfamily PH domain-like 4.47e-45
Family Phosphotyrosine-binding domain (PTB) 0.00051
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000012196
Domain Number - Region: 162-199
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00471
Family Mitotic arrest deficient-like 1, Mad1 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012196   Gene: ENSMPUG00000012293   Transcript: ENSMPUT00000012396
Sequence length 304
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896993.1:1503069:1553166:1 gene:ENSMPUG00000012293 transcript:ENSMPUT00000012396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKQIFNSLFTREFLHGMEILLQHEIKYLRKFLGSTEVEQPKGTEVVRDAVRKLKFARHIK
KSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSES
NKHLCYVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETEN
MELKNKVQDLESQLRTTQVSASPAGTGTPKSPSTDIFDMVPFSPVSHVTSTPARNGTQPP
PVPSRATEIKRDLFGAEPFDPFTCGAGDFPPDIESKLEEMQEGFKMGLTLEGTVFCLDPL
DSRC
Download sequence
Identical sequences M3YLI9
ENSMPUP00000012196 ENSMPUP00000012196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]