SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012245 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012245
Domain Number 1 Region: 71-182
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.73e-30
Family Ankyrin repeat 0.0008
Further Details:      
 
Domain Number 2 Region: 4-72
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-23
Family SH3-domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012245   Gene: ENSMPUG00000012340   Transcript: ENSMPUT00000012445
Sequence length 208
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897068.1:131871:177589:1 gene:ENSMPUG00000012340 transcript:ENSMPUT00000012445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKPPPKPVKPGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGL
IPSNYVAEQAESIDNPLHEAAKRGNLSWLRECLDNGVGVNGLDKAGSTALYWACHGGHKD
VVEVLFTQPNVELNQQNKLGDTALHAAAWKGYADIVQLLLEKGARTDLRNNEKKLALDMA
TNAACXXXXXXXXXXXXXXXXXXXXXXX
Download sequence
Identical sequences M3YLN8
ENSMPUP00000012245 ENSMPUP00000012245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]