SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012275 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012275
Domain Number 1 Region: 69-169
Classification Level Classification E-value
Superfamily E set domains 8.87e-30
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00017
Further Details:      
 
Domain Number 2 Region: 1-67
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.12e-22
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012275   Gene: ENSMPUG00000012369   Transcript: ENSMPUT00000012476
Sequence length 249
Comment pep:novel scaffold:MusPutFur1.0:GL896943.1:9978929:9980672:1 gene:ENSMPUG00000012369 transcript:ENSMPUT00000012476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSIDCAGILKLRNSDIELRKGETDIGRKNTRIRLVFHVHIPQPNGKVLSLQTASIPVE
CSQRSAQELPHIEEYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPQWEVEGKI
IRGKCQGAHIVLEVPPYHNPAVTAAVQVHFYLCNSKRKKSQSQRFTYTPVLMKQEHKEEV
DLSSVPALSVPHPAQTQRPSSDTGHPHDSVLSTQRSLLHFHLMKQLLTLSLNLKSKSLTF
QQLVCRTSL
Download sequence
Identical sequences M3YLR8
ENSMPUP00000012275 ENSMPUP00000012275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]