SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012319 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012319
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.31e-51
Family VHS domain 0.000000127
Further Details:      
 
Domain Number 2 Region: 150-303
Classification Level Classification E-value
Superfamily GAT-like domain 1.46e-32
Family GAT domain 0.00000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012319   Gene: ENSMPUG00000012413   Transcript: ENSMPUT00000012520
Sequence length 493
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896907.1:10280064:10322793:1 gene:ENSMPUG00000012413 transcript:ENSMPUT00000012520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDAFRAVKKRIVG
NKNFHEVMLALTVLETCVKNCGHRFHLLVASQDFVEGVLVRTILPKNNPPTIVHDKVLNL
IQSWADAFRSSPDLTGVVAVYEDLRRKGLEFPMTDLDMLSPIHTPQRTVFSSEAPSGQNS
VATDASHGGDPTQHTTPLPIQAALPSDTSITPTPEQIAKLRSELEMVSGNVRVMSEMLTE
LVPTQAEPADLELLQELNRTCRAMQQRVLELIPRIANEQLTEELLIVNDNLNNVFLRHER
FERFRTGQTGKAPQEAEAAADLIDMGPDQAVTSSLSSQLAGMNLGSSSVRAGLQSLEASG
QLEGEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQNTGAIPVTQACLMEDI
EQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLPSPSAEGPPGFPRGTAPRKK
TQEKKDEDTLFAL
Download sequence
Identical sequences M3YLW2
ENSMPUP00000012319 XP_004743160.1.14098 ENSMPUP00000012319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]