SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012335 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012335
Domain Number 1 Region: 51-212,354-647
Classification Level Classification E-value
Superfamily Ras GEF 9.29e-123
Family Ras GEF 0.00017
Further Details:      
 
Domain Number 2 Region: 763-857
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-41
Family Ras-binding domain, RBD 0.00000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012335   Gene: ENSMPUG00000012429   Transcript: ENSMPUT00000012536
Sequence length 888
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896954.1:2611022:2653177:1 gene:ENSMPUG00000012429 transcript:ENSMPUT00000012536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVDCQSCTQEIGEELLNGLIFSISLRKVQAQPGANKGQRWLGCENESALSLYETCKVRT
VKAGTLEKLVEHLVPAFQGSDLSYVTIFLCTYRAFTTTQQVLDLLFKRYGRRDALTASSR
YGCILPYSDEDGGPQDQLKNAVSSILGTWLDQYSEDFCQSPDFPCLKQLVAYVQLNMPGS
DLERRAHLLLAQLERAEPAQAEPEALYPAPAPAPVPETASELEPALAPTLLPTPEPDAAP
ARTPEPDAAPAPALEPDVAPAPAPAPTPEPDVAPAPTLEPDAAPAPALEADVAPAPAPEP
DAAPAPAPEPDAAPAPAPEPEPSLSQTLEPEAAPSPEPPWPSAVAAENGLNEKPHLLAFP
PDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDKKGKEHLAPTVRATVTQFNSVANCVIT
TCLADRSVTARGRARVVEHWIEVARECRVLKNFSSLYAILSALQSNSIHRLKKTWEEVSR
ESFRIFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPKRAQKRPKETGVIQGTVPY
LGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVIAQIKLLQSACNSYSIVPEEHFRAW
FRAMERLSETESYNLSCELEPPSESASNTLKAKKNAAIVKRWSDRQAPSGELSTSGSSHS
KSCDQLRCGPYLSSGDIADALSVHSAGSSSSDVEEINMSFVPESPDGQEKKFWESTSQSS
PETSGISSASSSTSSSSASTTPVAATRTHKRSMSGVCGCSSSLPLYNQQVGDCCIIRVSL
DVDNGNMYKSILVTSQEKAPAVIRKAMDKHNLDEDEPDDYELVQVISDDRKLKIPDNANV
FYAMNSTANYDFVLKKRTFTKGAKVRHGTSSTLPRMKQKGLKIAKGIF
Download sequence
Identical sequences M3YLX8
ENSMPUP00000012335 ENSMPUP00000012335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]