SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012363 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012363
Domain Number 1 Region: 144-309
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-31
Family Nuclear receptor ligand-binding domain 0.00008
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000012363
Domain Number - Region: 12-73
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0153
Family Nuclear receptor 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012363   Gene: ENSMPUG00000012457   Transcript: ENSMPUT00000012564
Sequence length 328
Comment pep:novel scaffold:MusPutFur1.0:GL897170.1:1482565:1483596:1 gene:ENSMPUG00000012457 transcript:ENSMPUT00000012564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPGEEEQSRLRVDCMGCGNMSSGKHRNFTGEGRESCFQQSIHSNRSYTGGSDHDCQIDQD
HLCQYCLLRRCSTAASRTRCLAPWPPPWAAPPGWALAAPGREHFPGQPVSELIAQLLGAK
PNPALSRRFSAGAFGADGAGRCEAVGLLFSTVEWARHAPFFPELPVARQVALLRPRWSEL
FHCASVGTAPARGAAPGRALHAGPFTHQVRAFQEQVDKLGRGQVDACLKAIALFTPDACG
LSDPAHENLQETAQVALMECVRAQYWSQPQHFGRPLLRLPALRALPASLNSQLFFMRLVG
KTPTEWLIRSIGPMALASDFAWTATPLA
Download sequence
Identical sequences M3YM06
ENSMPUP00000012363 ENSMPUP00000012363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]