SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012376 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012376
Domain Number 1 Region: 251-444
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.51e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 31-240
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.2e-48
Family BAR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012376   Gene: ENSMPUG00000012470   Transcript: ENSMPUT00000012577
Sequence length 880
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897170.1:1576838:1624869:1 gene:ENSMPUG00000012470 transcript:ENSMPUT00000012577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCFSCLRAGATDKEAACVLQPLQMAHLSLFCQIERRLDTVRSMCHHSHKRLMACFQGQH
GTDAERRYKKLPLTALAQNMQEASTQLEESLLGKMLETCGDAENQLALELTQHEVFVERE
IVEPLCSIAEVEIPNIQKQRKQLAKLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLKE
EMDEAGNKVELCKDQLAADMYNFMAKEGEYGKFFVTLLEAQADYHRKALAVLEKALPEMR
AHQDKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEEGLFRIGAGASKLKK
LKAALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWTQVASVQDQDKKLQ
DLWRTCQKLPPQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWAKTEGTLAE
MAAATSVHVVAVIEPIIQHADWFFPEEVEFNVSEAFVPLVTPNSNHSSHTGNDSDSGTLE
RKRPASMAVMEGDLVKKESFGVKLMDFQAHRRGGTLTRKHIAPAFQPPLPPTDGSTLAPA
GPEPPPQSSRAESSTGGGTVPSSAGTLEQGPSSGDSPPKPKDPAPAPAPARNSNQMATGQ
NQTQTTAGSHQLSVSPGHNSAGPSPHTLRRAVKKPAPAPPKPGNPPPGHPGGQSSPGTSQ
HLPSPSPKPTTRSPSPPAQHVGQAPGQPCTTSQPSAPRRYSSSLSPIQAPNHPPPQPPTQ
AALLGHSKPSSQGPPAPVALPSEPGLEQPLHTPPQTPTPPSTPPLGKQNPSLPASQTQAV
SNPEMAQPHTGTLPRPRPVPKPRNRPSMPPPPHPPGAHSAGDGTLTNAAPTASKIVTDTS
SRVSEPLRSTFPDMHSDSASKDLPGRILLDIDNDTESTAL
Download sequence
Identical sequences M3YM19
ENSMPUP00000012376 ENSMPUP00000012376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]