SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012378 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012378
Domain Number 1 Region: 85-114
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000294
Family LIM domain 0.01
Further Details:      
 
Domain Number 2 Region: 49-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000695
Family LIM domain 0.0034
Further Details:      
 
Domain Number 3 Region: 21-49
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000101
Family LIM domain 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000012378
Domain Number - Region: 115-146
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000772
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012378   Gene: ENSMPUG00000012472   Transcript: ENSMPUT00000012579
Sequence length 156
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896930.1:281681:317987:-1 gene:ENSMPUG00000012472 transcript:ENSMPUT00000012579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGE
VGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCN
QRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ
Download sequence
Identical sequences A0A0N8EUG1 A0A1S3G682 A0A1U7QN81 A0A1U7U687 A0A2I3LHP3 A0A2J8SVA5 A0A2K5D5J0 A0A2K5K417 A0A2K5MYG5 A0A2K5QXV3 A0A2K5U6F1 A0A2K6CDA9 A0A2K6FZ30 A0A2K6LFW9 A0A2K6NZZ5 A0A2K6UJ86 E2RLZ2 F6PHX6 G1S6X7 G3S5M4 H0UTR8 H2Q350 I3MWL7 M3YM21 P25800
9544.ENSMMUP00000019682 9606.ENSP00000338207 ENSMPUP00000012378 GO.56528 ENSP00000338207 ENSP00000338207 ENSPTRP00000005817 ENSCAFP00000010280 ENSCJAP00000021710 NP_002306.1.87134 NP_002306.1.92137 XP_001504951.1.31192 XP_002799696.1.72884 XP_002822108.1.23681 XP_003254951.1.23891 XP_003312955.1.37143 XP_003462488.2.53824 XP_003734256.1.60252 XP_003781125.1.62490 XP_003818173.1.60992 XP_003919861.1.74449 XP_003993134.1.62641 XP_004050700.1.27298 XP_004394608.1.74151 XP_004470327.1.11602 XP_004613678.1.94378 XP_004647388.1.9945 XP_004683132.1.23501 XP_004751967.1.14098 XP_004851435.1.39548 XP_005075758.1.91757 XP_005326889.1.77405 XP_005351029.1.66349 XP_005380275.1.28644 XP_005380276.1.28644 XP_005578765.1.63531 XP_006162957.1.99106 XP_006203556.1.17985 XP_006978624.1.50099 XP_008005938.1.81039 XP_008064248.1.4292 XP_008582551.1.73410 XP_009005885.1.60252 XP_010359565.1.97406 XP_010963205.1.22495 XP_010984228.1.51371 XP_011751388.1.29376 XP_011751389.1.29376 XP_011751390.1.29376 XP_011809767.1.43180 XP_011919126.1.92194 XP_011919127.1.92194 XP_011919128.1.92194 XP_012311814.1.9421 XP_012509708.1.63892 XP_012639408.1.48125 XP_012884185.1.60039 XP_013367161.1.28644 XP_014699723.1.49734 XP_014970419.1.72884 XP_014970420.1.72884 XP_015290660.1.63531 XP_016775790.1.37143 XP_017355828.1.71028 XP_017355829.1.71028 XP_017501830.1.32401 XP_017501837.1.32401 XP_017751866.1.44346 XP_019311759.1.44245 XP_020007127.1.5219 XP_021491927.1.76796 XP_021491928.1.76796 XP_021583060.1.77405 XP_851199.1.84170 ENSNLEP00000021266 ENSMMUP00000019682 ENSCAFP00000010280 ENSMPUP00000012378 gi|4505005|ref|NP_002306.1| ENSDNOP00000009710 ENSPTRP00000005817 ENSP00000338207 ENSMMUP00000019682 ENSNLEP00000021266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]