SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012407 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012407
Domain Number 1 Region: 1-305
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-67
Family Protein kinases, catalytic subunit 0.00000927
Further Details:      
 
Domain Number 2 Region: 775-825
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000194
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0078
Further Details:      
 
Domain Number 3 Region: 841-973
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000308
Family Pleckstrin-homology domain (PH domain) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012407   Gene: ENSMPUG00000012501   Transcript: ENSMPUT00000012608
Sequence length 1449
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897050.1:1273754:1293211:1 gene:ENSMPUG00000012501 transcript:ENSMPUT00000012608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMLHKWEMLKRAETACFREERDVLVKGDSRWVTALHYAFQDDEYLYLVMDYYAGGDLLT
LLSRFEDRLPPELAQFYLAEMVLAIHSLHQLGYVHRDVKPDNVLLDMNGHIRLADFGSCL
RLNNSGMVDSSVAVGTPDYISPEILQAMEEGKGHYGPQCDWWSLGVCAYELLFGETPFYA
ESLVETYGKIMNHEDHLQFPSDTPDVPAAARDLIRQLLCRQEDRLGRGGLDDFRNHPFFE
GVDWERLATSTAPYIPELRGPVDTSNFDVDDDTLNHPGTLPPPSHGAFSGHHLPFVGFTY
TSGSPDPESSSEQWAGLERQLRCLEQEKTELSRKLQEALQFSSDHRELERLRKEVQTLQG
RLSETPRDSKAQTDGGSPGQDGELRQERDGLVQELAEAQAGLRAQAQELHRAQERQEELL
QRLREAQEREAATASQTQTLSSQLEEAQESSRKLQAQVATLCREVTQLQRQRERSLEKDS
FRVKTIHTASETNGTGLPEAGPQEAQLRKEVAALRAQLEQARGHALSGKEEALCRLQEEN
RRLSLEQERLVEELEREQQSKQQLEGERRETESNWEAQIADILSWVNDEKVSRGYLQALA
TKMAEELESLRNVGTQTLPSRPLDHQWKARRLQKMEASARLELQSALEAEIRAKQSLQER
LTQMQEAQLQAESRLQEAQKQNQGLQQELAALREELAARGPGDTKPSNSLIPFLSLRSSE
KESTKDAGLSGEAPRPGVEPELRPEGRRSLRLGAVFPKAPAAPTAPAEGPPAKPGSHALR
PRTFPSPTKCLRCTSLMLGLGRQGLGCDACGYFCHSACAPQAPPCPVPPDLLRTALGVHP
ETGTGTAYEGFLSVPRPSGVRRGWQRVFAALSDSRLLLFDAPDPRLSPASGALMQALDLR
DPQFSATPVLASDVIHAQSRDLPCIFRVTASQLTVPPAVCTVLLLAESEAERERWLQVLG
ELQRLLLDTRPRPRPVYTLKEAYDNGLPLLPHALCAAIIDQDRLALGTEEGLFVIHLHSN
DIFQVGECRRVQRLAVSPAAGLLVVLCGRGPSVRLFALAKLESAEVVGAKIPESRGCQAL
AAGRILQARTPVLCVAVKRQVLCYQLGPGPGPWQRRIRELQAPAPVQSLGLLGDRLCVGA
AGAFALYPLLNEAAPLALGAGLVPEELPPSRGGLGEALGAVELSLSEFLLLFTTAGVYVD
SAGRKSRIHELLWPAVPTGWGYAAPYLTVFSENSIDVFDVRKAEWVQTVPLKKVRPLNPE
GSLFLFGTEKVRLTYLRNRLAEKDEFDIPDLTDNSRRQLFRTKSKRHFFFRVSEEQRQQR
RREMLKDPFVRSKLISPPTNFNHLVHVGPTDGKPSARDLPRAPEGKGRGTRSSGPQRPHS
FSEASRRPASVGSDGLSGDADAMKRKPWTSLSSESVSCPQGSLSPADSLIQVSERPRSLP
PAPESEGSP
Download sequence
Identical sequences M3YM50
ENSMPUP00000012407 ENSMPUP00000012407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]