SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012414 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012414
Domain Number 1 Region: 109-215
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.71e-45
Family RUNT domain 0.00000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012414   Gene: ENSMPUG00000012508   Transcript: ENSMPUT00000012615
Sequence length 507
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896902.1:2930062:3051106:-1 gene:ENSMPUG00000012508 transcript:ENSMPUT00000012615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQGGCRRREPQQRPGRLRVQGLE
PLAVAGCVSTARSRFPRADLVRLRSPQDDYTRILIICLYSACCVRTDTFLCCACKCNKKG
SMETTFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRG
KSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPH
PSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPS
IHSTTPLSSTRGTGLPAITDVPRRISGADTSTSDFCLWPSTLSKKSQAGASELGPFSDPR
QFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQS
GPFQTSSTPYLYYGTSSGSYQFPMVPGGDRSPSRMLPPCTTTSNGSTLLNPNLPNQNDGV
DADGSHSSSPTVLNSSGRMDESVWRPY
Download sequence
Identical sequences M3YM57
ENSMPUP00000012414 ENSMPUP00000012414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]