SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012468 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012468
Domain Number 1 Region: 40-284
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.37e-86
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000471
Further Details:      
 
Domain Number 2 Region: 285-494
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 8.37e-45
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00013
Further Details:      
 
Domain Number 3 Region: 620-798
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.75e-31
Family AlaX-like 0.027
Further Details:      
 
Domain Number 4 Region: 551-620
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000000742
Family AlaX-M N-terminal domain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012468   Gene: ENSMPUG00000012562   Transcript: ENSMPUT00000012670
Sequence length 1007
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896902.1:4058401:4070783:1 gene:ENSMPUG00000012562 transcript:ENSMPUT00000012670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSMAAAAGRLRRAIRRSPLWVSPSRQPLSSEPPPAQATAVRDAFLNFFRDRHGHRLVP
SASVRPRGDPSLLFVNAGMNQFKPIFLGTVNPRSEMAGFRRVANSQKCVRAGGRHSDLED
VGRDLSHHTFFEMLGNWAFGGEYFKEEACSMAWELLTQVYGIPEDRLWVSYFGGDPNAGL
DPDLESRDIWLSLGVPASHVLSFGPQENFWEMGDTGPCGPCTEIHYDLTGRVGAPQLVEL
WNLVFIQHNREADGSLQPLPQRHVDTGMGLERLVAVLQGTRSTYDTDLFSPLLKAIHQGC
GAPPYLGRVGAADEGRTDMAYRVVADHIRTLSICIADGVYPGMSGAPLVLRRILRRAVRF
STEVLRAPPGLLSSLVPIVVETLGDAYPELQKNSAQIASLISEDEAAFLASLQRGRRIID
RTLRRLGPAKLFPAEVAWSLSLSGNLGLPLDLLELMLEEKGVQLDSAGLARLAQEDAQHR
SQQAEPVQEQGLQLSVHALGELQRRGVPPTDDSPKYNYSLRPSGGYEFSTCEAQVLQLYT
EDGTAVASVGKGQRFGLLLDKTNFYAEQGGQASDRGYLTRVDQEDVLFPVARAQVCGGFI
LHEAVAPEDLKVGDQVQLHVDEAWRLGCMKKHTATHLLSWALRQALGPGTEQRGSHLNPE
RLRFDVATQAPLTSQQLRAVEGTVRDAVAQDKPVYVEDVALARTAHVPGLRCLDEVYPDP
VRVVSVGVPVAHALDPGSQAALQTSVELCCGTHLLRTGAIGDLVIVGERQLTRGTTRLLA
VTGEQAQQAREVGQNLAQEVEAATERLSQGSKDVVAAQRLSKDMGRLTDAVDLAMMPQWQ
RRELQATLKGLQRRANTAVRKLELGQAAQKTQELLQRHSQGPLIVDTVAAESLSVLVKVV
RQLCERVPGTSVFLLSPQQLGHVLCACQVAQSATPAFTAEAWALAVCSHMGGKAWGSQVA
ARGAGTTTDLEAVLSTARAYALDRLQPSSPTDLHRLHRQQTGPGQEL
Download sequence
Identical sequences M3YMB1
ENSMPUP00000012468 XP_004739847.1.14098 ENSMPUP00000012468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]