SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012479 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012479
Domain Number 1 Region: 423-556
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.31e-35
Family Synaptotagmin-like (S variant) 0.00085
Further Details:      
 
Domain Number 2 Region: 567-581,611-723
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.85e-31
Family Synaptotagmin-like (S variant) 0.004
Further Details:      
 
Domain Number 3 Region: 11-132
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.8e-26
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012479   Gene: ENSMPUG00000012573   Transcript: ENSMPUT00000012681
Sequence length 755
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896945.1:1486321:1620204:1 gene:ENSMPUG00000012573 transcript:ENSMPUT00000012681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKNSEFINLSFLLDHEKEMILGVLKRDEYLKKVEDKRIRKLKNELLEAKRRSGKTQQQT
NRVCVHCQRNLGLIFDRGDPCRACSLRVCSECRVPGLDGSWKCTVCAKVAQLRIITGEWF
FEEKAKRFKQVNVLGTDVVRQSILRRSPGTEETQSQEQSRQDPEKADTSPSSGQKASRDG
PRKKGFLLSKFRSATRGEIMTPKTESGRSYSLDLDSQNLRSLKSVPGSDRGSTGSSDLND
QEAGPSTPKSSRSSGVTPITQRSPAPSTHSVASVSFRKRHGFESSVDLAAIESTYENLTK
SHRRNVSGTPSIAVSEISLSSDRSRSELDLSGSYPEDLENTVNIRSKSVPGALDKDLDSL
EETEQGVHGLASSRFSANTHSLASGLSTNSQPGCDRKWTYLSVPDADSDTTSLNSMMSVY
SETGDYGNVKVSGEILLHISYCYKTGGLYIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDK
SRNNKRKTKIRTGTNPEFNETLKYTISHTQLETRTLQLSVWHHDRFGRNSFLGEVEIPFD
SWNFENPSDEWFVLQPKVEFAADIGLHYKGELTVVLRYIPPEENLMIPLEQVQGKKTFKR
GKKKESSVIFGGILEVLIKEAKNLTAVKSGGTSDSFVKGYLLPDDSKATKHKTLVVKKSV
NPQWNHTFMFSGLNPQDIKNVCLELTVWDKEAFSSNIFLGGVRLNSGTGVSHGKSVDWMD
SQGEEQRLWQKMADNPGTPVEGVLMLRSSMGKCRL
Download sequence
Identical sequences M3YMC2
ENSMPUP00000012479 ENSMPUP00000012479 XP_012912947.1.14098 XP_012912948.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]