SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012483 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012483
Domain Number 1 Region: 857-1253
Classification Level Classification E-value
Superfamily Ras GEF 2.62e-101
Family Ras GEF 0.0000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012483   Gene: ENSMPUG00000012577   Transcript: ENSMPUT00000012685
Sequence length 1265
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896954.1:3734511:3844844:1 gene:ENSMPUG00000012577 transcript:ENSMPUT00000012685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAAEKQKPRKRSRLCPWKQDSQRSHLSSFTMKLKDKFHSPKIKRTPSKKGKPAEASVK
TPEKPVSKEATDRFLPEGYPLPLDLEQQAVEFMSTSAVASRSQRQKNLSWLEEKEKEVVS
ALRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQSDPRTQHSSALSSCHSRVYQSL
ANLIRWSDQVMLEGVNSEDKEAVTTVKGVIKAVLDGVKELVRLTIEKQGHPSPTSPVKPS
SPACKPDGQSELPLTDREMEILNKTTGLSQSTELLPDSTDEEVAPPKPPLPGIRVVDNSP
PPALPPKKRQSAPSPTRVAVVAPMSRATSGSSLPVGINRQDFDVDCYTQRRLSGGSHSYG
GESPRLSPCSSIGKLSKSDEQLSSLDRDSGQCSRNTSCETLDHYDPDYEFLQQDLSNADQ
IPQQVACNLSPLPESLGESGSPFPGHPLQLPPAPPEGPSAAGQQMDMPPALPEKKRRSAA
SQTTDSSGCRVSYERHPSQYDNISEDDLPNPASVPSVPFTPFAAILPFQQGGSSASVEFV
GDFTAPESTGDPEKPPPLPEKKNKHMLAYMQLLEDYSEPQPSVFYQTPQNEHIYQQKNKL
LMEVYGFNDSFSTEAPQELAPPPALPPKQRQLQASCAAASLSSVSYCVQQTKVAFTPEDS
SATQGISVSVSNSFLSRHGTLPVPSSRSVFRSFSQDCVPHSPASVQPFLPPTSSSSPHFP
PVHQSQSSDLAGPTVASLPPSTVDGPLSSSQESNFHGNTVCLPSETSFTDSPQTPSSENT
SEEAGEGEYVNLYSSGQSSEELARSRGESPAMKDGHPRDPSSASSAAGKESRGGDRASRS
PDGSELARSEEEVDELSLIDHSEIMARLTLKQEGDDGPDVRGGSGDILLVHATETDRKDL
VLYCEAFLTTYRTFITPEELIKKLQYRYEKFSPFADTFKKRVSKNTFFVLVRVVDELCLV
ELTEEILKLLMELVFRLVCSGELSLARVLRKNILDKVDQKKLLRCANSDQPLAARGVAAR
PGTLHDFHSHEIAEQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNLTQFTEHFNNMSYW
VRSIIMLQEKAQDRERLLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIRRLEWQKQTSE
GLAEYCTLIDSSSSFRAYRAALSEVEPPCIPYLGLILQDLTFVHLGNPDYIDGKVNFSKR
WQQFNILDSMRCFQQAHYDIRRNEDIINFFNDFSDHLAEEALWELSLKIKPRNITRRKTD
REEKT
Download sequence
Identical sequences M3YMC6
XP_004757130.1.14098 ENSMPUP00000012483 ENSMPUP00000012483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]