SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012523 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012523
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily PX domain 1.15e-36
Family PX domain 0.000000183
Further Details:      
 
Domain Number 2 Region: 236-337
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.33e-26
Family PB1 domain 0.00000342
Further Details:      
 
Domain Number 3 Region: 170-233
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-18
Family SH3-domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012523   Gene: ENSMPUG00000012617   Transcript: ENSMPUT00000012725
Sequence length 339
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896907.1:11499500:11515434:1 gene:ENSMPUG00000012617 transcript:ENSMPUT00000012725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSYFVFVIEVKTKGGSKYLIYRRYR
QFYALQSKLEERFGPENKTSPFTCSLPTLPAKVYMGVKQEIAEMRIPALNAYMKSLLSLP
IWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKIKSESPQGAIIDRMAAPRAEALFD
FTGNSKLELNFKVGDVIFLLSRINKDWLEGTVRGATGIFPQSFVKILKEFPEEEDPTNWL
RCYYYEDTISTTKDIAVDEDLSSTPLFKDLLQLMRREFQREDIALNYRDTEGDLVRLLSD
EDVVLMVRQAQGLPSQKRLFPWKLHITQKDDYAVYNTVP
Download sequence
Identical sequences M3YMG6
ENSMPUP00000012523 ENSMPUP00000012523 XP_004743204.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]