SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012525 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012525
Domain Number 1 Region: 92-283
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.95e-70
Family T-box 0.00000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012525   Gene: ENSMPUG00000012619   Transcript: ENSMPUT00000012727
Sequence length 522
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897259.1:626527:635000:-1 gene:ENSMPUG00000012619 transcript:ENSMPUT00000012727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSSRALAFSVEALVQRPRKRKLQDPREETQPELLEKEGGEEERKRRATREKSQQPQKR
PKTEPSATAFSGYSSSDSDNNSCKNMEEKDAIQMELQGSELWKRFHDIGTEMIITKAGRR
MFPSVRVKVKGLDPGKKYYVAIDVVPVDSKRYRYVYHSSQWMVAGNTDHSCITPRFYVHP
HSPCSGDTWMQQIISFDGLKLTNNEMDDKGHIILQSMHKYKPRVHVMEQDSKVDLSRIQS
LPTEGVKTFSFKETEFTTVTAYQNQQITKLKIDRNPFAKGFRDPRRSRVVLDRLLEIYPW
RPSATLDFKTFGADTQCGSSGSSPVTSSGGAPSPLNSLLFPTCSVPTFHLPTGSLGMPCP
EVYLHNINLPLCYKICPTNFWQQQPLILPSPERLASSNSSQCLAPLMMEVSMFSSLGIAN
SKSSSFQDLSEQCLQAPNSSSQMLYGLQAPGSILSPNPIVQETIGCSFHPSYGFYRYNFS
VPSRLVNAANHLKVKVNDNNQVSFREGKCSHAHWYPTINHCL
Download sequence
Identical sequences M3YMG8
ENSMPUP00000012525 ENSMPUP00000012525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]