SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012545 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012545
Domain Number 1 Region: 7-292
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-80
Family Protein kinases, catalytic subunit 0.00000419
Further Details:      
 
Domain Number 2 Region: 729-925
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.32e-51
Family Nucleotide and nucleoside kinases 0.0000000664
Further Details:      
 
Domain Number 3 Region: 601-719
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-33
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 468-568
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-21
Family PDZ domain 0.0000162
Further Details:      
 
Domain Number 5 Region: 336-387
Classification Level Classification E-value
Superfamily L27 domain 1.88e-19
Family L27 domain 0.0000947
Further Details:      
 
Domain Number 6 Region: 397-448
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000459
Family L27 domain 0.0000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012545   Gene: ENSMPUG00000012639   Transcript: ENSMPUT00000012748
Sequence length 929
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896945.1:4629737:4988651:-1 gene:ENSMPUG00000012639 transcript:ENSMPUT00000012748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLK
REASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASH
YMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRV
GTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPR
QWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNA
RRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGAVSQVLDSLEEIHALTDCSEK
DLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPENNDAK
ELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVT
RVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVAN
QTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPS
TTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKN
GTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLV
TYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGK
NYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLR
TAEFAPFVVFIAAPTITPGLNELPKWCRKLPDESLQRLQKESDILQRTYAHYFDLTIINN
EIDETIRHLEEAVELVCTAPQWVPVSWVY
Download sequence
Identical sequences M3YMI8
ENSMPUP00000012545 ENSMPUP00000012545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]