SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012589 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012589
Domain Number 1 Region: 177-323
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-36
Family Third domain of FERM 0.00071
Further Details:      
 
Domain Number 2 Region: 83-179
Classification Level Classification E-value
Superfamily Second domain of FERM 2.36e-33
Family Second domain of FERM 0.000075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012589   Gene: ENSMPUG00000012683   Transcript: ENSMPUT00000012792
Sequence length 658
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896977.1:3216453:3322930:-1 gene:ENSMPUG00000012683 transcript:ENSMPUT00000012792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRAKSQVMLLLEAWRIFRVSRELQKRSHEWESGLPLKAACPPVTLAGGGAEQGGEGWI
AQNALHFHRGCYWKRNLSGTGDSCRYQFFLQVKQDVLQGRLPCPVNIAAQLGAYAIQSEL
GDYDPYTHTAGYVSEYRFVPDQKEELEEAIERIHKTLMGQAPSEAELNYLRTAKSLEMYG
VDLHPVYGENKSEYFLGLTPVGVVVYKNKKQVGKYFWPRITKVHFKETQFELRVLGKDCN
ETSFFFEARSKTACKHLWKCSVEHHTFFRMPENESNSLSRKLSKFGSMSYKHRYSGRTAL
QMSRDLSIQLPRPDQNVARSRSKTYPKRIAQTQPTGSNSINRVTANMDNGENEGTTKIIA
PSPIKSFKKAKNENSPDTQRSKSHAPWEDNGPQSGLYHSPNDRMKSPKFPYTRRRNPSCG
SDDSVQPTRRRKAHNSGEDSDLKQRRRSRSRCNTSSGSESENSNREHRKKRNRIRQENDM
VDSAPQWEAVLRRQKEKNQADPNNRRSRHRSRSRSPDIQAKEELWKHIQKELVDPSGLSE
EQLKEIPYTKVETQGDPIRIRHSHSPRSYRQYRRSQCSDGERSVLSEVNSKTDLVPPLPV
TRSSDAQGSGGSTVHQRRNGSKDSLIEEKSEASTSNLAGKHMAKTVKTVQASRLKIET
Download sequence
Identical sequences M3YMN2
ENSMPUP00000012589 ENSMPUP00000012589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]