SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012601 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012601
Domain Number 1 Region: 9-120
Classification Level Classification E-value
Superfamily SRP19 1.24e-39
Family SRP19 0.000000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012601   Gene: ENSMPUG00000012695   Transcript: ENSMPUT00000012804
Sequence length 146
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896977.1:3794917:3801347:1 gene:ENSMPUG00000012695 transcript:ENSMPUT00000012804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKMACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGL
NVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYVAEMIPKLKTR
TQKTGGGDQSLQQGEGSKKGKGKKKK
Download sequence
Identical sequences M3YMP4
ENSMPUP00000012601 ENSMPUP00000012601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]