SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012612 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012612
Domain Number 1 Region: 60-251
Classification Level Classification E-value
Superfamily Sec7 domain 7.06e-77
Family Sec7 domain 0.0000000406
Further Details:      
 
Domain Number 2 Region: 259-379
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000402
Family Pleckstrin-homology domain (PH domain) 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000012612
Domain Number - Region: 14-49
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 0.0916
Family AF0060-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012612   Gene: ENSMPUG00000012706   Transcript: ENSMPUT00000012815
Sequence length 393
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896907.1:11829658:11857890:1 gene:ENSMPUG00000012706 transcript:ENSMPUT00000012815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLCHPDPAELSSGETQELQQIKWHRKQLLEDIQKLKDEIADVFAQIDCFETAEESRLAQ
KEKELCIGRKKFNMDPVKGIQYLTEHKLLTPNVQDIAQFLYKGEGLNKTAIGTYLGERDP
FNLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMETFATRYCLCNPGVFQ
STDTCYVLSFSIIMLNTSLHNPNVRDRPPFERFVSMNRGINDGGDLPEEQLRNLFDSIKS
EPFSIPEDDGNDLTHTFFNPDREGWLLKLGWGRKWDRMWLRGASLQHDEEAGRTSNPQRG
AVAMCGKMAKHLDSGARTFCLELYNPSCRGQKIKACKTDGEGKVVEGKHESYRISASSAE
ERDQWIEAIRASITRVPFYDLVSARKKKIASKH
Download sequence
Identical sequences M3YMQ5
ENSMPUP00000012612 ENSMPUP00000012612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]