SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012637 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012637
Domain Number 1 Region: 17-307,415-455
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.32e-54
Family FAD-linked reductases, N-terminal domain 0.000000000359
Further Details:      
 
Domain Number 2 Region: 298-386
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.29e-16
Family L-aminoacid/polyamine oxidase 0.0000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012637   Gene: ENSMPUG00000012731   Transcript: ENSMPUT00000012840
Sequence length 521
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896945.1:6477137:6541592:-1 gene:ENSMPUG00000012731 transcript:ENSMPUT00000012840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPVQCLIVVSYCIFPPGMAAAKLLHDSGLNVVVLEARDRVGGRTYTIRNQKVKYVDLGGS
YVGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFSGPFPPVWNPIVYLDHNNLW
RTMDAMGREIPSDAPWKAPLAEEWDHMTMKELLDKICWTESAKQLATLFVNLCVTAETHE
VSALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDQVKLERPVTHID
QTGENVLVETLNHEVYEGSYVIRYQRKYLFDSPEGLLKNKIFGHVYSGGVLLCLVDSYRD
AHIRKKDYCGTMIIEGEEAPIAYTLDDTKPDGSYAAIMGFILAHKARKLARLTKEERLKK
LCELYAEVLGSQEALQCVRPSRTHWCLGRDRDFCFSSCWISPPPPAPPAQVSRVLRQPVG
KIYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITT
TFLERNLPSVPGLLKLIGLTAIFSATALGFLAHKRGLLLRV
Download sequence
Identical sequences M3YMT0
ENSMPUP00000012637 ENSMPUP00000012637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]