SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012657 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012657
Domain Number 1 Region: 60-450
Classification Level Classification E-value
Superfamily Ras GEF 2.22e-95
Family Ras GEF 0.00051
Further Details:      
 
Domain Number 2 Region: 546-600
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000124
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0017
Further Details:      
 
Domain Number 3 Region: 460-540
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000783
Family Polcalcin 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012657   Gene: ENSMPUG00000012752   Transcript: ENSMPUT00000012861
Sequence length 659
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897050.1:1367204:1380359:1 gene:ENSMPUG00000012752 transcript:ENSMPUT00000012861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAEPGPLGPSLRRWLGSARFPGSGFPGTGVLSEPCGRLRSAAGPSLPAPAVMAGTLDLDK
GCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYPQSRKDNSN
SLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIESVPTYKW
KRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTHGCTVD
NPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNFNTLMAVVGG
LSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFRFPILGVHLK
DLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDLLSLLTVSLD
QYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLDEWTSAAKPKLDQALMVEHIEK
MVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMISYFLRSSS
VLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVECR
RRAQSVSLEGSAPSPSPTHTHHRAFSFSLPRPGRRGSRPPEIREEDVQTVEDGVFDIHL
Download sequence
Identical sequences M3YMV0
ENSMPUP00000012657 ENSMPUP00000012657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]