SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012659 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012659
Domain Number 1 Region: 5-138
Classification Level Classification E-value
Superfamily PX domain 4.71e-39
Family PX domain 0.0000991
Further Details:      
 
Domain Number 2 Region: 250-345
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-23
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 150-223
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-18
Family SH3-domain 0.00036
Further Details:      
 
Domain Number 4 Region: 389-472
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-16
Family SH3-domain 0.00096
Further Details:      
 
Domain Number 5 Region: 870-936
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000144
Family SH3-domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012659   Gene: ENSMPUG00000012754   Transcript: ENSMPUT00000012863
Sequence length 938
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:8681723:8777678:1 gene:ENSMPUG00000012754 transcript:ENSMPUT00000012863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPRRSIVEVKVLDVQKRRVPNKHYVYIIRVTWSSGSTEAIYRRYSKFFDLQMQMLDKFP
MEGGQKDPKQRIIPFLPGKILFRRSHIRDVAVKRLIPIDEYCKALIQLPPYISQCDEVLQ
FFETRPEDLNPPKEEHVGKKKSGGDLTSVDPMVLEQYVVVADYQKQESSEISLSVGQVVD
IIEKNESGWWFVSTAEEQGWVPATCLEGQDGVQDEFSLQPEEVSWRYWSLPRPVGRRRTL
GDLYATSWRQEEKYTVIYPYTARDQDEMNLERGAVVEVIQKNLEGWWKIRYQGKEGWAPA
SYLKKNSGEPLPPKLGPGSSTHTGVLDLDGVSRQQSSMGRDRELLNNQRDGRFEGRPVPD
GDIKQRSPKMRQRPPPRRDMTIPRGLNLPKPPIPPQVEEEYYTIAEFQTTIPDGISFQAG
LKVEVIEKNLSGWWYIQIEDKEGWAPATFIDKYKKTSNASRPNFLAPLPNELTQLHPGDA
AALENNTGTEAIGPSRPLPDAPHAAVDSGMPWSKDWKGGKEALRKASSDMSSCTGYEEIS
SPDLEEKPSLPPRKESIIKSEGELQERERQRMEQLRGSSPKPPGMILPMIPAKHTPPARD
SRRPEPKPDKSKLFQLKNEMGLECGHKVLAKEVKKPNLRPISKSKADPPEEKPEVIPQNP
FLKSKPQVRPKPAPSPRTEPLQGEDQVDICNLRSKLRPAKSQEKPSLDGESSPQAAGGQE
VAFSRSFLPGDGPGHAQDRTGRQDGLSPKEMSCRAPPRPAKTTDPVPKSATTPVQEAPPQ
RPVVLPRRPPPPKKTSSASRPLPEVRGPQREASEGKAAPAPGRALLVPPKAKPSLSNSSG
SQDDMRGRGGLGPRMVGKIGENREKLAATPFPNADGPKDSLYVAVANFEGDGDTSSFQEG
TVFEVREKNSSGWWFCQVLSGAPSWEGWIPSNYLKKKP
Download sequence
Identical sequences M3YMV2
ENSMPUP00000012659 ENSMPUP00000012659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]