SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012676 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012676
Domain Number 1 Region: 227-334
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-21
Family SH3-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012676   Gene: ENSMPUG00000012771   Transcript: ENSMPUT00000012880
Sequence length 336
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896914.1:124129:144214:-1 gene:ENSMPUG00000012771 transcript:ENSMPUT00000012880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAILSVIKAGFLVT
ARGGSGVVLARLPDGKWSAPSAIGIAGLGGGFEVGIEVSDLVIILNYDRAVEAFAKGGNL
TLGGNFTVAVGPLGRNLEGNVALRSSAAVFTYCKSRGLFAGVSLEGSCLIERKDTNRKKY
RRDKKLFKNVFLSIRSPCLATYDSGHNNYESFSFPLSGRRILNMSRWLHNIHQATDVPPT
PTPGPQPPPARGPRSNGHKCKLYPELPGLPQRVGYLDEPVEVTALYSFEGQQPGDLNFQA
GDRITVISKTDSQFDWWEGKLRGQTGIFPANYVAMN
Download sequence
Identical sequences M3YMW9
ENSMPUP00000012676 ENSMPUP00000012676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]