SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012683 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012683
Domain Number 1 Region: 491-634
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 1.71e-50
Family gamma-adaptin C-terminal appendage domain-like 0.000000113
Further Details:      
 
Domain Number 2 Region: 10-154
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.2e-45
Family VHS domain 0.000000201
Further Details:      
 
Domain Number 3 Region: 172-300
Classification Level Classification E-value
Superfamily GAT-like domain 4.51e-41
Family GAT domain 0.000000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012683   Gene: ENSMPUG00000012778   Transcript: ENSMPUT00000012887
Sequence length 634
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896907.1:12101067:12119448:1 gene:ENSMPUG00000012778 transcript:ENSMPUT00000012887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAMEPETLEARINRATNPLNKELNWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQE
WEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLY
SWTVGLPEEVKIAEAYQMLKKQGIVKSDPKLPDDATFPLPPPRPKNVIFEDEEKSKMLAR
LLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVSAIEEVNNNVKLLTEMVMSHSQGGA
SARSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVISLYKQLVRG
EEVNGEAAAGSGSLPGSTSALLDLSGLDLPPAGTTYPPMPTRPADPASPEQPSTSVSLLD
DELMSLGLSDPTPPPGPSLDGAGWNSFQSSDGAEPPAPPRVPNTDSQTPLPASSGLDDLD
LLGKTLLQQSLPPESQQVRWEKQQPAPRLTLRDLQNKSNCSSPSSSAPSLLHAASPEPPG
PLQQPTTTDFSLASITVPLESIKPSSILPVTVYDQHGFRVLFHFARDPLPGRSDVLVVVV
SMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEK
VRLRYKLLFTMGDQTYNEMGDVDQFPPPETWGSL
Download sequence
Identical sequences M3YMX6
ENSMPUP00000012683 XP_004743247.1.14098 ENSMPUP00000012683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]