SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012689 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012689
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.69e-24
Family THAP domain 0.00023
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000012689
Domain Number - Region: 127-184
Classification Level Classification E-value
Superfamily Prefoldin 0.000186
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012689   Gene: ENSMPUG00000012784   Transcript: ENSMPUT00000012893
Sequence length 230
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897119.1:538187:546669:-1 gene:ENSMPUG00000012784 transcript:ENSMPUT00000012893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKKWEAAVRRKNFKPTKYSSICSEHFTP
DCFKRECNNKLLKENAVPTIFLCTEPHDKKIQSSVNKCRSLPLHPSVLSACSQVDATIGL
LMPPLQTPDNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLE
KLKEVVHFQKEKDDISERGYVILPNDYFEIVEEFHLKKITLEYLYKNIQN
Download sequence
Identical sequences M3YMY2
ENSMPUP00000012689 ENSMPUP00000012689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]