SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012691 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012691
Domain Number 1 Region: 344-541
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00017
Further Details:      
 
Domain Number 2 Region: 95-234,263-326
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.22e-47
Family BAR domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012691   Gene: ENSMPUG00000012786   Transcript: ENSMPUT00000012895
Sequence length 774
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896907.1:12119905:12138227:1 gene:ENSMPUG00000012786 transcript:ENSMPUT00000012895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGSPILQKTSFTLPYLLFPGLNPFRQTPLGRLPRAQHAHFSIQQIWSTYCMPNCDSGGG
PKKELLLSLGDESSAPITALQEERQGLRQGLPNTPETAEFLGEDLQQVEQRLEPAKRAAH
NVHKRLQACLQGQSGADMDKRVKKLPLMALSTTMAESFKELDPDSSMGKALEMSCAIQNQ
LARILAEFEMTLERDVLQPLSKLSEEELPIILKHKKSLQKLVSDWNTLKSRLTQAAKNSG
GGQGLGGGTGSYGHTATATKMETLKEEEEELKKRVETSKDEYLADLYHFATKEDTYANYF
IHLMEIQADYHRKSLSSLDTALAELRENHSQADPSPLMTATALGVYGVPLETHLQNLGRD
IALPIEACVMMLLSDGMKEEGLFRLAAGASVLKRLKQTMASDPCSLQEFCSDPHAVAGAL
KSYLRELPEPLMTFDLYDDWLKAASLKESGARLEALQQVCGRLPWESFNNLRYLLKFLAR
LAEEQEVNKMTPSNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQVVGVVEALIQKADTL
FPGDINFNVSGLFSAPDSQDKVSHRPEAEELPTIAVATPGPAPPPAPAPAPAPAPASAPA
PVSVATKERAESEVPPRPASPKVSRSPSEAATPTEDMARKTKRPAPARPTMPPPQVSSTR
SSPPAPLAPPGSSSPVTPQALPRRLVGGNLRAPTVPPPLPPNPPQPARRQSRRSPASPSP
ASPGPASPSPGANVQVDLGVAPEDGGAPEAVGRASTPPAIPPQPRPRSLASETD
Download sequence
Identical sequences M3YMY4
ENSMPUP00000012691 ENSMPUP00000012691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]