SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012716 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012716
Domain Number 1 Region: 114-305
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-41
Family Pleckstrin-homology domain (PH domain) 0.0085
Further Details:      
 
Domain Number 2 Region: 3-83
Classification Level Classification E-value
Superfamily EF-hand 0.00000517
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012716   Gene: ENSMPUG00000012811   Transcript: ENSMPUT00000012920
Sequence length 585
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896930.1:1454843:1526082:1 gene:ENSMPUG00000012811 transcript:ENSMPUT00000012920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGLKDELLKAIWHAFTALDLDHSGKVSKSQLKVLSHNLCTVLKVPHDPVALEEHFRDDD
EGPVSNQGYMPYLNKFILEKVQDNFDKIEFNRMCWTLCVKKNLTKSPLLITEEDAFKIWV
IFNFLSEDKYPLIIVPEEIEYLLKKLTEAMGGGWQQEQFEHYKINFDDSKDGLSVWELIE
LIGNGQFSKGMDRQTVSMAINEVFNELILDVLKQGYMMKKGHKRKNWTERWFVLKPNIIS
YYVSEDLKDKKGDILLDENCCVESLPDKDGKKCLFLIKCFDKTFEISASDKKKKQEWIQA
IHSTIHLLKLGSPPPHKEARQRRKELRKKLLAEQEELERQMKELQAANENKQQELETVRK
KLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVR
ELEDMYLKLQEALEDERQARQDEETVRKLQARLLEEESSKRAELEKWHLEQQQAIQTTEA
EKQELENQRVMKERALQEAMEQLAQLELERKQALEQYEGVKKKLEMATSKTKSWKDKVAQ
HEGLIRLIEPGSKHPHLITNWGPAAFTQAELEEREKSWKGRRSTE
Download sequence
Identical sequences M3YN09
ENSMPUP00000012716 XP_004752017.1.14098 ENSMPUP00000012716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]