SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012725 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012725
Domain Number 1 Region: 1185-1324,1438-1726
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.36e-109
Family Myotubularin-like phosphatases 0.0000091
Further Details:      
 
Domain Number 2 Region: 1785-1984
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-30
Family Pleckstrin-homology domain (PH domain) 0.0000224
Further Details:      
 
Domain Number 3 Region: 956-1098
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-17
Family GRAM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012725   Gene: ENSMPUG00000012821   Transcript: ENSMPUT00000012930
Sequence length 1987
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896930.1:1541049:2011658:-1 gene:ENSMPUG00000012821 transcript:ENSMPUT00000012930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRSRLTARKGFPSQRGWGRGRSGRSARRRRRPRLGCQTWLKCRRCRYCRCRENAEPSRA
RWAAAARAATGTCFSGAAAAAMARLADYFIVVGYDHEKPGSGAGLGKIIQRFPQKDWDDT
PFPQGIELFCQPGGWQLSRERKQPTFFVVVLTDIDSDRHYCSCLTFYEAEINLQGTKKEE
IEGEVEVSGLIQPAEVFAPKSLVLVSRLDYPEIFRACLGLIYTVYVDSLNVSLESLIANL
CACLVPAAGGSQKLFSLGAGDRQLIQTPLHDSLPVTGTSVALLFQQLGIQNVLSLFCAVL
TENKVLFHSASFQRLSDACRALESLMFPLKYSYPYIPILPAQLLEVLSSPTPFIIGVHSI
FKTDIHELLDVIIADLDGGTIKIPECIHLSSLPEPLLHQTQAALSLILHPDLEVADHAFP
PPRTALSHSKMLDKEVRAVFLRLFAQLFQGYRSCLQLIRIHAEPVIHFHKTAFLGQRGLV
ENDFLTKVLNGMAFAGFVSERGPPFRSCDLFDELVAFEVERIKVEENNPLKIIKHVRELA
EQLFKNENPNPHMAFQKVPRPTEGSHLRVHILPFPKINETRVQELIQENLAKNQNAPPAS
RMEKKCVVPAGPPVVSIMDKVTTVFNSAQRLEVVRNCISFIFENKTLETEKTLPAALRAL
KGKAARQCLTDELGLHVQQNRAILDHQQFDYIIRMMNCTLQDCSSLEEYNIAAALLPLTS
AFYRKLAHGVSQFAYTCVQDHPIWTNQQFWETTFYNAVQEQVRSLYLSATEDNHAPHLKR
KEKLPDDRNQEKTAMDLAAEQLRLWPSLSKATQQELVQREESTVFSQAIHFANLMVNLLV
PLDTSKNKLLRTSAPGDWESGSNSIVTNSIAGSVAESYDTESGFEDSENNDIANSVVRFI
TRFIDKVCTESGVTQDHIKSLHCMIPGIVAMHIETLEAVHRESRRLPPIQKPKILRPALL
PGEEIVCEGLRVLLDPDGREEATGGLLGGPQLLPAEGALFLTTYRILFRGTPHDQLVGEQ
TVVRSFPIASITKEKKITMQNQLQQNMQEGLQITSASFQLIKVAFDEEVSPEVVEIFKKQ
LMKFRYPQSIFTTFAFAAGQTTPQIILPKQKEKNTSFRTFSKTIVKGAKRAGKMTIGRQY
LLKRRTGTIVEERVNRPGWNEEDDISVSDDSELPTSTTLKASEKSTMEQLVEKACFRDYQ
RLGLGTISGSSSRSKPEYFRITASNRMYSLCRSYPGLLVVPQAIQDSSLPRVARCYRHNR
LPVVCWKNSRSSTLLLRSGGFHGKGVVGLFKSQNSPQAAPTSSLESSSSIEQEKYLQALL
NAVSVHQKLSGNNTLTVRPALALSPGTERRTSRMSTVLKQVVPGHLDVNPSNSFARGVHG
YRDKCFTQSNPKSSTKGRVHNQGVWASLRSSTRLISSPTSFIDVGARLAGRDHSASFSNS
TYLQNQLSKRQAALYIFGEKSQLRNFKLEFALNCEFVPVEFHDIRQVKTSFKKLMRACVP
STIPTDSEVTFLKALGDSEWFPQLHRIMQLAVVVSEVLENGSSVLVCLEEGWDITAQVTS
LVQLLSDPFYRTLEGFRMLVEKEWLSFGHKFSQRSSLTLNCQGSGFTPVFLQFLDCVHQV
HNQYPTEFEFNLYYLKFLAFHYVSNRFKTFLLDSDYERLEHGTLFDDKGDKHAKKGICIW
ECIDRMHKRSPIFFNYLYSPVEIEALKPNVNVSSLKKWDYYIEETLSTGPSYDWMMLTPK
QFPCEDSEAAGGAGPQSQRRTVWPCYDDVSCAQPDALTSLFGEIEKLEHKLNQTPEKWQQ
LWEKVTVDLKEEPRADRLQRHPSGSPGIVSTNLTSCQKRSLLHLPDSSMGQEHSASISPS
NGVDRRAATLYSQYASRNDENRSFEGTLYKRGALLKGWKPRWFVLDVTKHQLRYYDSGED
TNCKGHIDLAEVEMVIPAGPSMGAPKHTSDKAFFDLKTSKRVYNFCAQDGQSAQQWMDRI
QSCISDA
Download sequence
Identical sequences M3YN18
ENSMPUP00000012725 ENSMPUP00000012725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]