SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012734 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012734
Domain Number 1 Region: 129-457
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 5.49e-112
Family Rap/Ran-GAP 0.000000000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012734   Gene: ENSMPUG00000012831   Transcript: ENSMPUT00000012940
Sequence length 714
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896917.1:218597:415006:-1 gene:ENSMPUG00000012831 transcript:ENSMPUT00000012940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLASLKVKKQELANSSDVTFPDRPLSPPLTAPPTMKSAEFFEMLEKMQGIKLEEQKPGPQ
KNKDDYIPYPSIDEVVEKGGPYPLIVLPQFGGYWIEDPENVGTPTSLGSSICEEEEEDSL
SPSTFGYKLECRGEARAYRRHFLGKDHLNFYCTGSSLGNLLLSIKCEEAEGIEYLRVILR
SKVKTVHERIPLAGLNKLPSVPQIAKAFCDDAVGLKFNPVLYPKASQMIVSYDEHDVNNT
FKFGVIYQKARQTLEEELFGNNEESPAFKEFLDLLGDTITLQDFKGFRGGLDVTHGQTGV
ESVYTIFRDREIMFHVSTKLPFTEGDAQQLQRKRHIGNDIVAIIFQEENTPFVPDMIASN
FLHAYIVVQAENPGTETPSYKVSVTAREDVPAFGPPLPSPPVFQKGPEFREFLLTKLTNA
ENACCKSDKFAKLEDRTRAALLDNLHDELHSHTQAMLGLGPEEDKFENGGHGGFLESFKR
AIRVRSHSMETMVSSQKKQHSGGIPGSLSGGISHNSMEVTKTTFSPPAASAAAAAKNQSR
SPIKRRSGLFPRLHTGSEGQGDGRTRCDSASSNPKTPDGAHSSQEMKSEASSNPSSPEIC
PNKEKPFIKLKENGRANISRSSSSTSSFSSTAGEGEAMEECDSGSSQPSTTSPFKQEVFV
YSPSPSSENPSLGAAATPIIMSRSPTDPKSRNSPRSNLKFRFDKLSHASSSAGH
Download sequence
Identical sequences M3YN27
ENSMPUP00000012734 XP_012908935.1.14098 ENSMPUP00000012734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]