SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012737 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012737
Domain Number 1 Region: 1466-1561
Classification Level Classification E-value
Superfamily PH domain-like 2.02e-24
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012737   Gene: ENSMPUG00000012835   Transcript: ENSMPUT00000012944
Sequence length 2037
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896907.1:12184128:12235114:1 gene:ENSMPUG00000012835 transcript:ENSMPUT00000012944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEPGNPPSAEPPYCDLPRRPPASEDPPRSSASGCPSVVGPGLGPGLQRKARIKGPSAGSS
AEVPTAASGSQSQELEAGPSLEDLASCLGGSFDEGLDSGTSSSPDHDTPDDTSDSSSVDW
NTVARQEEAPSWDELTVMIPRKPQEGPRADSARKAPSLLTRSPVGGDAAGQRKEDPCSGS
RSAGQHWAKLRGESGHFLEWHRSVLTQVSRATLPGGPRGASPQASSLHRSAQKDAAQTAS
TQEKPRTSSTQQDIPRPAFTQHNTPRASSPSRIAQRDDPRTSSVQRSNLRVSSPTRTTKQ
DNSRTXPRDNSRTPCPQRDNPRGASPNRTTPRDNSRTPCPQRDNPRGSSPNRTTPRDNSR
APCPQQDNPRGASPNRSTLRDNPRTPCPQRDNPRGASPSRTTPRDNSRTPCPQRDNPRGA
SPNRSTQRDNSRTPCPQRDNPRGSSPNRTTQRDNPRTPCPQRDNPRGASPSRTTPRDNPK
ASCIQQNNPRTSYSQRDNPQSSSQRDSPGASSPRCCTKRDHPGPSPPPRSAQQNNARNSS
PHRTNKDIPWASFPLRPTQSEGPRTSSPSRSKQSEVPWASIALRPTQGDRPPQTSSPTRP
AQRDPPLSSSGSAQHGSPSQAASSFHNPGPHSASRTSSPLYPATRGAPQTSSEPSQPPCS
VCIGHRDAPRASSPPRYLQHDPFPFFPEPHASETELPHHTPPYIPPAVCIGHRDAPRASS
PPRHTQFDPFPFLPDTSDTETQSTQHDPPQLPPPVCIGYRDAPRASSPPRQPPEPFLLFQ
DLPRASTESLVPSTDSLHEPPHMPTPVCIGHRDAPSFSSPPRQAPEPSLFFQDLPGTSME
SLAPSTDSLHGSPVLPPQVCIGHRDAPRASSPPRHPPSDLALLAPSPPPGSSGGSRGSAA
PGETRHNLEREEYTMLADLPPPRRLAQREPGPQCSNGGRTRSPGRAEVERLFRQERRKSE
APGAFQARDEGRSQRPSQGQSQLLRRQSSPALSREVTKPLAKQAEPARRSQVEPCRPRSP
ERRPEGDRRLQGTSLPPRTSARTPERERRTERPLESGRAGPRQPLGGWRSQEGPPGTQGP
HRHLERGCSSPQEGPGLGDWQGLGEPSRGLARAPEGTWRGPLRESEESWEQEGGPTGHRG
QAEAWEEPPGNRFREAPDRPALRGWASLQELPSAHQTKSPPENSRVGPEEFLKSQRPEIP
TTMGWGAEGTRPPLHSPERRSELDWKDLVGLLGVPREGAWGRIEESMLTSHLPRLDWEGL
LELLRAQLPRKDPAGHWGPPAPASGGPPAPASGPEVGSPGTNGTLELERQGQPDGWEEST
LVNGQSQSAGQWPGSSAQPPSPACTSTQWPKTRVTRGPETSPMAGLEEMGQLGSRSPAEG
PSLPEWEFQSEEPEESEPSKGQDSLTDQKHADSADKRPAEGKAGSPLKGRLVTSWRMPGD
RPTLFNPFLLSLGVLRWQRPDLLNFKKGWMSILDEPGEWKKHWFVLTDSSLKYYRDSTAE
EADELDGEIDLRSCTDVTEYAVQRNYGFQIHTKDAVYTLSAMTSGIRRNWIEALRKTVRP
TTAPDVTKLSDCNKENALHGYSTQKGSLKAGEQRGGSEVIGRGGPRKADGQRQALDYVEL
SPLTQGAPQRVRGPARTLDRPAKQEELERDLAQRSEERRKWFEATDGRPPETAAGEGPRR
GLGAPLTEDQQNRLSEEIEKKWQELEKLPLRENKRVPLTALLNQSRGERRGPPGDSHEAL
EKEVQSLRAQLEAWRLQGEVPQGAPRSQEDGHIPPGYISQEACERSLAEMESSHQQVMAE
LQRHHERELQRLQQEKEWLLAEETAATASAIEAMKKAYQEELSRELSKTRSLQQGPDGLR
KQHQSDVAALKRELQVLSEQYSQKCLEIGALTRQAEEREHTLRRCQQEGQELLRHNQELH
ARLSEEIDRLRSFIASQGTGDGCGRGSERSSCELEVLLRVKENELQYLKKEVQCLRDELQ
MLQKDKRFTSGKYQDVYVELNHIKTRSEREIEQLKEHLRLATAALQEKESMRNSLAE
Download sequence
Identical sequences M3YN30
ENSMPUP00000012737 ENSMPUP00000012737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]