SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012762 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012762
Domain Number 1 Region: 483-635
Classification Level Classification E-value
Superfamily Spectrin repeat 5.33e-30
Family Spectrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 707-847
Classification Level Classification E-value
Superfamily Spectrin repeat 3.88e-29
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 3 Region: 1246-1401
Classification Level Classification E-value
Superfamily Spectrin repeat 6.55e-29
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 4 Region: 185-322
Classification Level Classification E-value
Superfamily Spectrin repeat 7.08e-29
Family Spectrin repeat 0.00063
Further Details:      
 
Domain Number 5 Region: 1722-1828
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-28
Family Spectrin repeat 0.0000096
Further Details:      
 
Domain Number 6 Region: 1776-1933
Classification Level Classification E-value
Superfamily Spectrin repeat 9.55e-28
Family Spectrin repeat 0.000095
Further Details:      
 
Domain Number 7 Region: 91-220
Classification Level Classification E-value
Superfamily Spectrin repeat 8.34e-27
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 8 Region: 1352-1505
Classification Level Classification E-value
Superfamily Spectrin repeat 8.04e-26
Family Spectrin repeat 0.00022
Further Details:      
 
Domain Number 9 Region: 2045-2157
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-25
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 10 Region: 641-741
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-22
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 11 Region: 1584-1703
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-22
Family Spectrin repeat 0.0000797
Further Details:      
 
Domain Number 12 Region: 929-1011
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-21
Family SH3-domain 0.00013
Further Details:      
 
Domain Number 13 Region: 1510-1615
Classification Level Classification E-value
Superfamily Spectrin repeat 2.73e-20
Family Spectrin repeat 0.00043
Further Details:      
 
Domain Number 14 Region: 1887-2038
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-18
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 15 Region: 2164-2271
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-17
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 16 Region: 1167-1261
Classification Level Classification E-value
Superfamily Spectrin repeat 3.96e-16
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 17 Region: 851-923
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000619
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 18 Region: 2356-2426
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000455
Family EF-hand modules in multidomain proteins 0.062
Further Details:      
 
Domain Number 19 Region: 2267-2391
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000922
Family Calmodulin-like 0.012
Further Details:      
 
Domain Number 20 Region: 10-69
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000492
Family Spectrin repeat 0.00012
Further Details:      
 
Domain Number 21 Region: 1032-1120
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000851
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 22 Region: 325-377
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000648
Family Spectrin repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012762   Gene: ENSMPUG00000012860   Transcript: ENSMPUT00000012969
Sequence length 2434
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897121.1:813954:877023:-1 gene:ENSMPUG00000012860 transcript:ENSMPUT00000012969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGGPKVLETAEQIQERRQEVLTRYKRFKDLVAERGQKLEDSYQYQVFRRDAEDLEKWI
LEKLKIADDXLSAHISMSCRSSVVLCLLPKAHLEELHRLWDLLLELTQERGVLLLRALKL
QQYLQECADILEWIGDKETIVTSVELGEDWERTEALHKKFEEFQADLEARREKVEEINKY
ARESAEENHPELPLIKLKQDEVNEAWERLLSLALQRQETLSSAADLQRFRRDVTEAIQWI
KEKEPQVTSEDYGKDLVTSEALFHSHKGLERSLAVMEDKVKELCARADKLMLSHPPEASQ
IQQMKEDLVSNWGHIRALATNRYAKLEASYGYQRFLSDYEELSGWMKEKAALISADELPT
DVASGEALLDRHRQHKVDRKSPPPPGGNILSCGHSTRLTLTREPLVTFRHNMRVLFKRAN
IEKSNHTNFYHPFFYSTKHIIMTWKFIVYYLLFQENLRDSLPQLETVLKKNLDIKNIMAS
KTFQTVDNNATKLINGGHYDSENIAALRDSLLARRDALRKKAATRRKLLEDSWLLQKLYE
DSDDLKNWINKKKKLADDEDYKDIQNLKSRVQKQEEFKNELEDYQRLLDTLEKTGQEMIE
ADHYASDKVAERMDEVVSLWKELLAATEQKGNQLHEANQELQFKNTAEDLERWLGDVEQQ
VASKDYGKGLSDVQNLLRKHGFLESAVGAHQDQVDTLTDLAVYFEKIDHPDAGDIKARQE
SLVSRFEALKEPLSARKKTLIDHLLLHQICRDTEDEEAWIQETEPSVASTYLGKDLIVSK
KLLNRHQVIQDNIASHEPSIQAITEKGNKMVEEGHFAAEDVASRVKSLNDNMESLQARAS
RRRNDLEANVQFQQYLADLNEAEAWIQEKEPIVDNTNYGADEEAAGALLKKHEAFLVDLS
AFGNSMQALRDQAAACQQQQAAPVEGAAREQRVVALYDFQARSNREVTMKKGDVLTLLSS
INKDWWKVESGDHQGFVPAVYVRKLAQDELPAPPQRQREDPSSIAQRQEQIENQYVFRSR
FHNTIPRLSVSAHRYRSLLDRAEERRRRLLQRYNEFLLAYEAGDMLEWIQEKKAENTGVE
LEDVWELQKKFDEFQTDLKTNEPRLRDINKVADDLLFEKLLTPEGAQIRQNLMFHRSARQ
AEDGKPASGWYVVSVAVHRGKKPTEASEELNTRWNSLQSLAEEQRQLLGSAHAVQVFQRE
ADDMKEQIEKKRQALQVADPGSDLFSVQALQRQHEIFERDFMPLGEKVTMLVETAERLSE
SHPDAADDLRRQGTELKEAWDSLLKDSEERKENLNEAQKFYTFLMRARDLENWISNIGGL
VSSEELAEDLIGTEILLERHQERRADMEAEAPTFQALEDFGAELISSGHRSSPEIEDKLE
AVRLKKDNLEKAWNQRKRILDQCLELQLFHGNCDQAESWMLARENFLRSEGHSSLDTLAA
LQKKRDDLDEAIASQEKKITELDHVVERLIADDHYAKEEIAARFQRVQDRWNALKELLTA
ELKRLGAYADLKKFHHDLEDLEEWISEMLPVACDESYKDPTNIQRKFVKHQAFEKEVLGR
ADEVEGVLRLGESLIDQKACDISEETMKDQLKDLEDHWNHLLEKTIDKGQKLEEASRQQR
FNTGIQDFKFWLSEAETLLAMKDQARDLASAGNLLKKHQLLETEMLARKDALKDLNELAA
DLLSSGTFNVDQIVEERDNVNERFLNVQDLAAAHHEKLKEAYALFQFFQDLDDEESWIEE
KLLRVSSQDYGRDLQGVQNLLKKQKRLEGELVAHEPTIQSVLDAADRLGDKAAVGQEEIQ
ERLTQLFQHWEELKELAAARGHRLEESLEYLEFLQNAEEEEAWISEKEAMVTRGGSGDTL
AMTQSLLKKHETLESDFAVHETRVQDICAQGEDILNKEKSQQKEKISAKIESLKEKIPSL
SMAIKAWKLQLEDDRAFQQFNWKADMVEAWIAEKEASLKTNGNGTDLAASLTLLAKQDTL
DASLQSFQRDRLSEITDLKDQLVAAQHSQAKAIEQRHDALLRRWEQLLEASAAHKEKLLE
KQLPLQQAEELFMEFAHKASAFNHWCENAEEDLSEPVHCVSLNAVRQLQKDHEAFLASLA
GAQSDFNNLLELDQQIKALNVPSSPYTWLTMEVLEKFWKNLSDIIKEREQELQKEEARQV
KNFEMRQEFEQNASAFLQWILETRAYFLDGSLLKETGTLESQLEANKRKQKEIQAMKRQL
TKIEDLGDSLEEALVLDIKYSTIGLAQQWDQLHQLGMRMQHNLEQQIQAKDTIGVSEETL
KEFSTTYKHFDENLTGRLSHKDFRSCLRGLNYYLPMVEEDEPEPKFEKFLDVVDPGRKGY
VSLEDYTSFLIDKESENIKSSDEIENAFQALAEGKAYITKEDMKQALTPEQVQFCASHMQ
QYVDPRGKSHLAGYDYVGFTNSFFGNGEAAFPES
Download sequence
Identical sequences M3YN55
ENSMPUP00000012762 ENSMPUP00000012762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]