SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012766 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012766
Domain Number 1 Region: 1-231
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.99e-65
Family FCH domain 0.00000000197
Further Details:      
 
Domain Number 2 Region: 275-299,496-553
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-16
Family SH3-domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000012766
Domain Number - Region: 349-420
Classification Level Classification E-value
Superfamily HR1 repeat 0.00392
Family HR1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012766   Gene: ENSMPUG00000012864   Transcript: ENSMPUT00000012973
Sequence length 561
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896954.1:5038962:5178495:1 gene:ENSMPUG00000012864 transcript:ENSMPUT00000012973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWGTELWDQFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQLRNLAKKYQPKKNSK
EEEEYRYTACKAFLSTLNEMNDYAGQHEVISENMTSNITVELARYVQELKQERKSARQQA
QVRHQMAEDSKADYSSILQKFNHEQHEYYYTHIPNIFQKIQEMEERRIVRIGESMKTYAE
VDRQVIPIIGKCLDEIVKAAESIDQKNDSQLVIEAYKSGFEPPGDIEFEDYTQPMKRTVS
DNSLSNSRGEGKPELKFGGKSKGKLWPFIKKNKLMSLLTSPHQPPPPPPASASPSAVPNG
PQSPKQQKEPLSHRFNEFMVSKPKIHCFRSLKRGLSLKLGATPEDFSNLPPEQRRKKLQQ
KVDELNKEIQKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLTEVSQNIEKLRLEAQKFE
AWLAEVEGRLPARSEQARRQSGMFDAQNPATVNSCAQDRESPDGSYTEEQSQEGEGKVLA
TDFDDEFDEEEPLPAIGTCKALYTFEGQNEGTISVAEGETLYVIEEDKGDGWTRIRRNED
EEGYVPTSYVEVYLDKNAKDP
Download sequence
Identical sequences M3YN59
ENSMPUP00000012766 ENSMPUP00000012766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]