SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012786 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012786
Domain Number 1 Region: 806-973
Classification Level Classification E-value
Superfamily Sec7 domain 1.23e-57
Family Sec7 domain 0.0000445
Further Details:      
 
Domain Number 2 Region: 1019-1154
Classification Level Classification E-value
Superfamily PH domain-like 7.5e-28
Family Pleckstrin-homology domain (PH domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012786   Gene: ENSMPUG00000012884   Transcript: ENSMPUT00000012993
Sequence length 1281
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897119.1:1585194:2206724:1 gene:ENSMPUG00000012884 transcript:ENSMPUT00000012993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQPEQQQMRTSFLFIQLQAPPAGALPSRSTAAPGGPEEGHIFPGPRTGLLAGRGLRRT
QGLAAPPLRLLQKGGSGTEEPAAFSCSALKEEEREEKPQDLDGRRGGVCRSPRHRPSLAT
ASRKFGRLQPLSCSLPSPAPVMSDESSDSSMGWEHWPAISAPQDLWSTDPWSWDALGCSV
PQANLAHPTDRGESVTLKTAVATCQVLPKSYEEGTGTTGRARRARLYRYSPHIQTSQSYP
APPATLPLKAETFVWVNNASAHSQSVAKAKYEFLFGRSEEKPPDTSDHGGSTLLPPNVTN
EFPEYGTMEESGEGLRTSLGFDTESLPGGPQGQQGVQLFDDHHSGPDSVAEGPKDVRESL
SQSHLKEQSLQPIDSLISTLKATEARIASGTLQATKVLDKDATSSFSVQQVDKEQDTAPH
KTKRQRANKSFPSGHEKGPDIPLSAEVTTEENSYLSIQKNLTVLLTGETQAELSKVTDDG
RKGALRVQEPACPVSSLGSPAVTHTSAGSVRFLRERRSDQGSSTGRPGRVKHVEFQGVEI
LWTGGEKRETQQPVDFEIPLERTTSPESREFSRVPSHLISSAGLYNSVGLTESVWDETWN
ASSENPGTGSGTFSPLPLVDSGEDEVFLKDNKEHLEKKPELERDKERTHEQEEHLRGGDD
DILGPGYTEDSTDVYSSQFETILDNTSLYYSAESLETLYSEPDSYFSFEMPLTPMIQQRI
KEGSQFLERTSVAGQQDVLSVSADGGIVMGYSSGITNGLTDTSDSIYMKGMPEIAFWGSN
AGVKTTLLEAHSDMGSTEILEKETSESLSNGTSSNIEAAKRLAKRLYQLDRFKRSDVAKH
LGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQERERVLIHFSNRYFYC
NPNTIASQDGVHCLTCAMMLLNTDLHGHNIGKKMTCQEFIANLQGINEGGDFSKDLLKAL
YNSIKNEKLEWAVDDEEKKKSPSEGTDEKANGTHPKTISRIGSTTNPFLDIPHDPNAAVY
KSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGTVLYLQKDEYKPEKALSEEDLKNAVS
VHHALASKATDYEKKPNVLKLKTADWRVLLFQAQSPEEMQGWINKINCVAAVFSAPPFPA
AIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPPDKKVKAKEIDEY
RLKDHYLEFEKTRYEIYVSILKGGGKELLSNNENEAAGLKKSHSSPSLNPDSSPVTAKVK
RNVSERKDHRPETPSIKQKVT
Download sequence
Identical sequences M3YN79
ENSMPUP00000012786 ENSMPUP00000012786 XP_004775787.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]