SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012828 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012828
Domain Number 1 Region: 213-239,267-504
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-68
Family Nuclear receptor ligand-binding domain 0.00000000182
Further Details:      
 
Domain Number 2 Region: 160-245
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.28e-30
Family Nuclear receptor 0.00000936
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012828   Gene: ENSMPUG00000012927   Transcript: ENSMPUT00000013036
Sequence length 506
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897050.1:1692792:1701197:-1 gene:ENSMPUG00000012927 transcript:ENSMPUT00000013036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTAGPTPAVSWRKQSRKRPRCPFVSYKPPAAPPSEGTRRGGAVRPEEAAEEGPFAAPGS
PRRSGPLGPHACPPALPEPQVTSAMSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVA
LAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASC
EACKAFFKRTIQGSIEYSCPASNECEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRG
GRQKYKRRPEVDPLPFPSSFPAGSLAVAGGPRKTAPVNALVSHLLVVEPEKLYAMPDPAG
PDGHLPAVATLCDLFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRS
LPLQDELAFAEDLVLDEEGARAAGLGELGAALLQLVRRLQALRLEREEYVLLKALALANS
DSVHIEDAEAVEQLREALHEALLEYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLA
HFYGVKLEGKVPMHKLFLEMLEAMMD
Download sequence
Identical sequences M3YNC1
ENSMPUP00000012828 ENSMPUP00000012828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]