SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012850 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012850
Domain Number 1 Region: 323-415
Classification Level Classification E-value
Superfamily BRCT domain 2.33e-17
Family DNA-repair protein XRCC1 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012850   Gene: ENSMPUG00000012950   Transcript: ENSMPUT00000013059
Sequence length 587
Comment pep:known scaffold:MusPutFur1.0:GL897019.1:1837590:1856894:1 gene:ENSMPUG00000012950 transcript:ENSMPUT00000013059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGLEKKKYERGSATNYITRNKARKKLQLSLADFRRLCILKGIYPHEPKHKKKVNKGSTA
ARTFYLLKDIKFLLHEPIVNKFREYKVFVRKLRKAYGKSEWNTVERLKDNKPNYKLDHIV
KERYPTFIDALRDLDDALSMCFLFSTFPRTGKCHVQTIQLCRRLTVEFLHYVIAARALRK
VFLSIKGIYYQAEVLGQPIVWITPYAFSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQ
SLNLHYPPKLEGQAYTEAKTSEDTYALDSESSMEKLAALGNSLARMVVPAEEEAEVDEFP
ADGEMTAQEEDRRKELEAQEKHKKLFEGLKFFLNREVPREALAFVIRSFGGDVSWDQSLC
IGATYDVTDSCITHQIVDRPGQQTPVIGRYYVQPQWVFDCVNARLLLPVADYFPGVQLPP
HLSPFVSEKEGDYVPPEKLKLLALQRGEHPENMDESEEEDEEEDNDGDGDEGGENEEEEE
EDAEAGSEKEEEARLTALEEQRLEGKKPRVMEGTVKLEDKERLAQEEENEAKRLAIMMMK
KREKYLYNKIMFGKRRKIREANKLAEKRKAHDEAVRSQKKAKKARPV
Download sequence
Identical sequences G9KG15
ENSMPUP00000012850 XP_004766487.1.14098 ENSMPUP00000012850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]