SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012856 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012856
Domain Number 1 Region: 10-141
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000861
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000012856
Domain Number - Region: 515-563
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000196
Family PLC-like (P variant) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012856   Gene: ENSMPUG00000012956   Transcript: ENSMPUT00000013065
Sequence length 963
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896977.1:7285472:7366537:1 gene:ENSMPUG00000012956 transcript:ENSMPUT00000013065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSKSDQLLIVVSILEGRHFPKRPKHLLVVEAKFDGEQLATDPVEHTDQPEFATELAWEI
DRKALHQHRLQRTPIKLQCFALDPVSSAKETIGYIVLDLRTAQETKQAPKWYQLLSNKYT
KFKTEIQIGIALETDTKAPVDSFKAKGAPPRDGKVPASLSGLDPKDIVVVLNEEGGYHQI
GPAEYCSDFFIMSVTIAFATQLEQLIPCTMKLPERQPEFFFYYSLLGNDVTNEPFNDLIN
PNFEPERASVRIRSSIEILHVYLALQSKLQIHLCCGDQSLGSTEVPLTGLLKKGSTEINQ
RPVTVEGAFILDPPNRAKQKLAPIPVELAPTVGVSVALQREGIDAQSLIELKTQNEHELQ
HSKKQVLTPIKEKTLTGPKSPSVSPVPPQNPSPPTKDDATGSEAESLQYDKDTKPNPKAV
GPSIPASVAQPVPASHASETASGQKIAVPATSHHFCFSIDLRSIHDLEVGFPINCILRYS
YPFFGSAAPIMTNPPIEVRKNMEVFLPQSYCAFDFATLPHQLQDTFLRIPLLVELWHKDK
MSKDLLLGIARIQLSNVLSSEKTRFLGSSGEQCWRQTYSESVPFIAAQGSNNRIMDLSYT
VTLEDYGLVKMREILVSDSSQGLSAVQQKPPSVPPAPCPSEVLTEPRETLEYKAALELEM
WKEMQEDIFENQLKQKELAHMQALAEEWKKRDRERESLVKKKVAEYTVLEGKLQKTLIDL
EKREQQLVLAESEVQRERKELKLERERNLQELQDSIRRAKEDCVHQVELERLKMRQLEED
KLRLQQQLNDAENKYKILEKEFLQFKDQQSNKPEIRLQSEINLLTLEKVELERKLESATK
SKLHYKQQWGRALKELARLKQREQESQMAHLKKQQEELEQMRLRYLAAEEKDTVKTERQE
LLDIRNELNRLRQQEQKQYQDSREIASGKLDSPRGNALEEGLDDYLTRLIEERDTLMRTG
GRW
Download sequence
Identical sequences M3YNE9
ENSMPUP00000012856 ENSMPUP00000012856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]