SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012876 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012876
Domain Number 1 Region: 11-68
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000000549
Family Calponin-homology domain, CH-domain 0.00073
Further Details:      
 
Domain Number 2 Region: 151-180
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000257
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 120-150
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000799
Family LIM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012876   Gene: ENSMPUG00000012976   Transcript: ENSMPUT00000013085
Sequence length 806
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896907.1:12341245:12371251:1 gene:ENSMPUG00000012976 transcript:ENSMPUT00000013085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVQSFRQERDFDSLSKDNVFENNRLAFEVAEKELGIPALLDPSDMVSMSVPDCLSIMTY
VSQYYHHFASPGQAGVSSPGKAQAPSSPPSEAPTPAEPGDRAQGEELSSGSLSEQGAQRT
PSSTCAACQQHVHLVQRSLVEGKLYHRHCFRCRQCSSTLLPGAYKSGPEEGTFVCAEHCA
RLGPGGRSGATSGPPLQPKQQQLAEEVKDVDGGGVGRSAPAGAEADVPKASPEARPQIPT
KPPLPSKAQELGSSSPAGRPTPAPRKAPESPALTPPTPRPRSSLQHENLAEQGGSSGLVN
GRLHEPPVPKPRGTPKLSERTPAPRKDPPWITLVQAEPRKKPAPLPPSSSPGPPSREGRR
VVNGGTEESQGQEEQSQVPAGPEPKPYNPFEEEEEEEESPAAPSPAAGPALAHSAEVTPK
SLHPWYGITPTSSPKTKKRPAPRAPSASPLALHTARLSHSEPPSATPSPALSVESLSSES
SSQTPSGELLEPPAVPKSSSEPAVHAPGTPGTSASLSTHSSLSSSGELVQPSADQIPQAG
PGLAPSTRGSPGPQPAKPCSGAAPTPLLLVGDKSPVPSPGTSSPQLQVKSSCKENPFNRK
ASPTASPTTKKTTKGSKPARPPAPGHGFPLIKRKVQADQYIPEEDIHGEMDTIERQLDAL
EHRGVLLEEKLRGGVNEGREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADV
EYELRCLLNKPEKDWTDEDRGREKVLMQELMALIEQRNAIVNCLDEDRQREEEEDKMLEA
MIRRKEFQKEAEPEGKKKGKFKTMKD
Download sequence
Identical sequences M3YNG9
ENSMPUP00000012876 ENSMPUP00000012876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]