SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012890 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012890
Domain Number 1 Region: 1613-1749
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.29e-26
Family Gelsolin-like 0.00088
Further Details:      
 
Domain Number 2 Region: 2011-2074
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 1.57e-20
Family VHP, Villin headpiece domain 0.00053
Further Details:      
 
Domain Number 3 Region: 1297-1409
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 9.81e-19
Family Gelsolin-like 0.0017
Further Details:      
 
Domain Number 4 Region: 1734-1849
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 7.25e-18
Family Gelsolin-like 0.0044
Further Details:      
 
Domain Number 5 Region: 1831-1982
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 9.82e-17
Family Gelsolin-like 0.004
Further Details:      
 
Domain Number 6 Region: 1445-1487,1515-1555
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0000000000000257
Family Gelsolin-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012890   Gene: ENSMPUG00000012989   Transcript: ENSMPUT00000013099
Sequence length 2074
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897157.1:377378:460333:1 gene:ENSMPUG00000012989 transcript:ENSMPUT00000013099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHRKERIARRLEGIETDTQPILLQSCTGLVTHRLLEEDTPRYMRATDPASPHTGRSNEEE
DTSDSSVEKQTRSKLCTETSGIHAESSCGSGLMDTQALESKAERIARYKAERRRQLAEKY
GIALDSEADSESPSRYTKSRKDADAADKRGGKGDRQAEPGKESCSLYSKDYALSGGDGLS
DTEVLLNVENQRRGQEPSTTGQARDLAPTVESSSSFPFPGRDCAFSEVPRSPKQMHSVSL
SSPRPPASPSHSAGDPPLPPEARTRVKVREKMVKEESARSSPEVASEPFTQRRHQPVPIH
CSSFQSENSAFDRVLSKAASSAGQPIRDYVQPADPIHTATLVTSEILENVSECSWGGSAA
QNVRKPPTLKVLESERRDTPVLHICESKAEEDMLFTEALEKSRKSLLALEDHGLMRSHED
PSGNDDVGKPAGSPVPSEHQKEPESLSHPPPSQQLPAERISRQEMVLYVQSQPVSQDARA
TGHRQEALVKKRKVLTRSLSDYTGPPPLQALKGKDPASRQELEPQSYKAEGPPPEVGVLD
TKVSVAQLRNAFLESVHASKKPELSASHSEMPAAEGKTKVDERAKLSVAAKRLLFREMEK
SFDEKNVPKRRSRNAAVEQRLRRLQDRSHTQPVTTEEVAIAATLQASAHHKALARDQANE
GKDSAEQGEPDSSTLSLAEKLALFNKLSQPVSKAISTRNRIDMRQRRMNARYQTQPVTLG
EVEQVQSGKLIPFSPTVNTSVSTVASMVTPMYAGDLRTKLSVDDNTSATDYKFPSSIENS
DSPVRSILKSQAWQPSAESSGSRGMLREFGEAESKRVLTGGDGGKKYGSFEEAEPPCPTF
NRVREGDSHKEPKYAVPRKGSLELGHPPVAHLGDELKEFSMGKSLAQGSPDLKDRQHFEE
KVDMENVPRRKFSLRAAEFGEPPSEQTGLAAGKTVAPTAAPVSWRQQDPAEPGQEKYSRS
PCAMFAAGEIKVPAVEGILDSAGKTMSIKERLALLKKSGEEDWKNRLIRKQEYGKASVTS
SLHIQETEQSLKKKRVTESRESQMTIEERKHLISVREEAWKTKGKGAANDSTQFTVAGRM
VKKGLASPTAITPVASPLCSKTRGTTPVSKPLEDIEARPDMQLESDLKLDRLETFLRRLN
NKVGGETVLTVTGKSVKEVMKLDDDETFARFYRSMDDTIPRSPVELDEDFDVIFDPYAPK
LTSSVAEHKRAVRPKRRVQASKNPLKMLAAREDLLQEYTEQRLNVAFMESKRMKVEKMSA
NSNFSEVTLAGLASKENFSNISLRSVNLTEQNSNNSAVPYKKLMLLQIKGRRHVQTRLVE
PRASSLNSGDCFLLLSPHYCFVWVGEFANVIEKAKASELASLIQTKRELGCRATYVQTIE
EGINTHTHAAKDFWKLLGGQTSYQSAGDPKEDELYETAIIETNCIYRLMDDKLVPDDDYW
GKIPKCSLLQSKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQLAKHLWNGTFDYENCDINP
LDPGECNPLIPRKGQGRPDWAIFGRLTEHNETILFKEKFLDWTELKRPNEKSASELAQPK
EDPRAEAKPYDVALMVPVPQATAGTVLDGVNVGRGYGLVEGDDRRQFEIASVSVDVWHIL
EFDYSRLPKQSIGQFHEGDAYVVKWKYMVSTAVGSRQKGEHSVRVAGKEKCVYFFWQGRQ
STVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVHSGRREEEEENAQSE
WRLYCVRGEVPMEGNLLEVACHCSSLRSRTSMVVLNVNKALIYLWHGCKAQAHTKEVGRT
AANKIKEQCPLEAGLHSSSKVTIHECDEGSEPLGFWDALGRRDRKAYDCMLQDPGNFNFT
PRLFILSSSSGDFAATEFMYPARDPSVVNSMPFLQEDLYSAPQPALFLVDNHHEVYLWQG
WWPTENKITGSARIRWASDRKSAMETVLRYCKGKNIKRPPPKSYLIHAGLEPLTFTNMFP
SWEHREDIAQITELDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYL
TDEDFEFALDMTREEYNTLPAWKQVNLKKAKGLF
Download sequence
Identical sequences M3YNI3
ENSMPUP00000012890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]