SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012903 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012903
Domain Number 1 Region: 138-266
Classification Level Classification E-value
Superfamily PX domain 1.05e-31
Family PX domain 0.001
Further Details:      
 
Domain Number 2 Region: 303-514
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000279
Family BAR domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012903   Gene: ENSMPUG00000013002   Transcript: ENSMPUT00000013112
Sequence length 519
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896977.1:7859074:7915059:-1 gene:ENSMPUG00000013002 transcript:ENSMPUT00000013112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEREPPPLGDAKPTDFEELEDGEDLFTSTVSTLESSPSSPEPASFNAEDVSTNSNGPK
PAAVVLDDDREDLFAEATEEVSLDSPEREPILSSEPSPAVTPVTPTTIIAPRIESKSMSA
PVIFDRSREEIEEEANGDVFDIEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKSEFSV
KRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKEDSSSTEFVEKRRAALE
RYLQRTVKHPTLLQDPDLRQFLESSELPRAVNTQALSGAGILRMVNKAADAVNKMTIKMN
ESDAWFEEKQQQFENLDQQLRKLHASVEALVCHRKELSANTAAFAKSAAMLGNSEDHTAL
SRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRVKCWQKWEDA
QITLLKKRETEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGRFEK
ERVKDFKTVIIKYLESLVQTQQQLIKYWEAFLPEAKAIA
Download sequence
Identical sequences M3YNJ6
ENSMPUP00000012903 ENSMPUP00000012903 XP_004761412.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]