SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012917 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012917
Domain Number 1 Region: 512-832
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-85
Family Protein kinases, catalytic subunit 0.0000014
Further Details:      
 
Domain Number 2 Region: 335-435
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 3.53e-45
Family MAST3 pre-PK domain-like 0.0000143
Further Details:      
 
Domain Number 3 Region: 1113-1203
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-18
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012917   Gene: ENSMPUG00000013016   Transcript: ENSMPUT00000013126
Sequence length 1801
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:3529869:3737160:-1 gene:ENSMPUG00000013016 transcript:ENSMPUT00000013126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRSRCRDRPQPPPPAGRREDGAQRAVELPQPQPLPPRRRAPPGRQLLEERTGLSGPEVR
EQEVIAGLSPLLFRKLSNPDIFSSTGKAKLQRQLSQDDCKLRRGSLASSLSGKQLLPLSS
SVHSSVGQVTWQSSGEASNLVRMRNQSLGQSAPSLTAGLKELSLPRRGSFCRTSNRKSLI
VTSNTSPTLPRPHSPLHGHTGNSPLDSPRNFSPNAPAHFSFVPARSHGHRADRTDGRRWS
LASLPSSGYGTNTPSSTVSSSCSSQEKLHQLPFQPTADELHFLTKHFSTESVPDEEGRQS
PAMRPRSRSLSPGRSPVSFDSEIIMMNHVYKERFPKATAQMEERLAEFISSNTPDSVLPL
ADGTLSFIHHQVIEMARDCLDKSRNRLITSHYFYELQENLEKLLQDAHERSESSEVAFVM
QLVKKLMIVIARPARLLECLEFDPEEFYHLLEAAEGHAKEGQGIKCDIPRYIVSQLGLTR
DPLEEMAQLSSYDSPDTPETDDSVEGRGASLTSKKTPSEEDFETIKLISNGAYGAVFLVR
HKSTRQRFAMKKVNKQNLILRNQIQQAFVERDILTFAENPFVVSMFCSFETKRHLCMVME
YVEGGDCATLLKNIGALPVDMVRLYFAETVLALEYLHNYGIVHRDLKPDNLLITSMGHIK
LTDFGLSKIGLMSLTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWA
MGIILYEFLVGCVPFFGDTPEELFGQVISDEIVWPEGDDALPPDAQDLTSKLLHQNPLER
LGTGSASEVKQHSFFTGLDWTGLLRQKAEFIPQLESEDDTSYFDTRSERYHHVDSEDEEE
VSEDGCLEIRQFSSCSPRFSKVYSSMERLSLLEERRAPPPTKRSLSEEKDDRSDGLAGLK
GQDRSWVIGSPEILRKRLSVSESSHTESDSSPPLTVRRRCSGLLDAPRFPEGPEEASSTP
RRQQQEGTWLLTPPSGEGVSGPAPERPVERRLKLDEEPFGQSCGSSSAVETPGGRGTPQL
TEGATAKAISDLAVRRARHRLLSGDSVEKRTARPINKVIKSASATTLSLLIPAEHTSSPL
ASPMSPHSQSSNPSSRDSSPSRDFLPALSSSRPPIIIHRAGKKYGFTLRAIRVYMGESDI
YTVHHMVWHVEDGGPASEAGLRQGDLITHVNGEPVHGLVHTEVVELILKSGNKVSISTTP
LENTSIKVGPARKGSYKAKMARRSKRSRGKDGQESRKRSSLFRKITKQASLLHTSRSLSS
LNRSLSSGESGPGSPTHSHSLSPRSPTQGYRVTPDAVHSVGGNSSQSSSPSSSVPSSPAG
SGHTRPSSLHGLAPKLQRQYRSPRRKSAGSIPLSPLAHTPSPPPAASPQRSPSPLSGHGA
QAFPAKLHLSPPLGRQLSRPKSAEPPRSPLLKRVQSAEKLAAALAASEKKLATSRKHSLD
LPHPELKKELPPREVSPLEVVGTRSVLSGKGVLQPSPSWALGTLRQDRAERRESLQKQEA
IREVDSSEDDAEEGPENSQGVREPNSAPTPEVGRAAPLTGAGEGEEEDAFLSKDPKSQGR
VVSGLLTEVTLKPPRMEGSSVPQRELGIPQAFEEAASSSSAAPSLGEAEPTDPIPPEGCW
KAQHFHTQALTALCPSSSGPVPTSRSAASSTSGEPGRWSWKFLIEGPDRASPSRKATMEG
GMASSQDLETITPAHPENLSPRQEGKSWPPGAPGLVHPPCEFPHQSRLWEPKCAEREKEE
PDLGITKVPDASGDRRQDIPCRSCPLIQEPGPSLLRRGRDPGGPQKHQDLALVPDELLKQ
T
Download sequence
Identical sequences M3YNL0
ENSMPUP00000012917 XP_004740473.1.14098 ENSMPUP00000012917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]