SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012937 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012937
Domain Number 1 Region: 142-353
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.97e-66
Family Arfaptin, Rac-binding fragment 0.0016
Further Details:      
 
Domain Number 2 Region: 18-100
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-17
Family PDZ domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012937   Gene: ENSMPUG00000013036   Transcript: ENSMPUT00000013146
Sequence length 417
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896907.1:12464894:12486271:1 gene:ENSMPUG00000013036 transcript:ENSMPUT00000013146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAAL
DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKK
VKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYEL
SQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLN
KAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRC
RQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPI
EVDLAHTTLAYGLGQDEFTDGEEEEDEDDEDTAAGEPSRDARGAAGPLDKGGSWCDS
Download sequence
Identical sequences M3YNN0
ENSMPUP00000012937 XP_004743264.1.14098 XP_004743265.1.14098 XP_004743266.1.14098 XP_004743267.1.14098 ENSMPUP00000012937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]