SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012962 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012962
Domain Number 1 Region: 661-789
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000124
Family Synaptotagmin-like (S variant) 0.0044
Further Details:      
 
Domain Number 2 Region: 4-38
Classification Level Classification E-value
Superfamily WW domain 0.00000000000459
Family WW domain 0.0012
Further Details:      
 
Domain Number 3 Region: 53-88
Classification Level Classification E-value
Superfamily WW domain 0.000000000779
Family WW domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012962   Gene: ENSMPUG00000013058   Transcript: ENSMPUT00000013171
Sequence length 1110
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:12145159:12296240:-1 gene:ENSMPUG00000013058 transcript:ENSMPUT00000013171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPELPLPEGWEEARDFDGKVYYIDHTSRTTSWIDPRDRYTKPLTFADCISDELPLGWE
EAYDPQVGDYFIDHNTKTTQIEDPRVQWRREQEHMLKDYLVVAQEALSAQKEIYQVKQQR
LELAQQEYQQLHAVWEHKLGSQVSSFSRSSNMACYKPGDLLKELEWTESKVNKLKREMVH
LQQELQFKERGFQTLKKIDKKMSDAQGSYKLDEAQAVLRETKAIKKAITCGEKEKQDLIK
SLAMLKDGFRTERGSHSDLWSSSSSLESSGFPLPKQYLDVSSQTDISGSFATSSNNQLAE
KVRLRLRYEEAKRRIANLKIQLAKLDSEAWPGVLDSERDRLILINEKEELLKEMRFVSPR
KWTQGEVEQLEMARKRLEKDLQAARDTQSKALTERLKLNSKRNQLVRELEEATRQVAALH
SQLKSLSSSMQSLSSGSSPGSLTSSRGSLAASSLDSSTSASFTDLYYDPFEPLDSELQSK
VEFLILEGATGFRPSGCITTIHEDEVAKTQKAEGGSRLQALRSLSGTPKSMTSLSPRSSL
SSPSPPCSPLIADPLLTGDAFLSPLEFEDPELSTTLCELSLGSSTRERYQLDEPGTEGKP
LGQAMNTAQGCSLKVACVSAAVSDESVAGDSGVYEASVQRLGASEAAAFDSDESEAVGTT
RVQIALKYDEKNKQFAILIIQLSNLSALPLQQDQKVNIRVAILPCSESTTCLFRTRPLDA
SDTLVFNEMFWVSMSYPALHQKTLRVDVCTTDRSHLEECLGGAQISLAEVCRSGERSTRW
YNLLSYKYLKKQSREPKPVGAKVSTPGPESTDAVSALLEQTAVELEKRQEGRSSTQTLED
GWRYEETSENEAVAEEEEEEEEEEGEDVFAEKASPDRDEGPALKVDKETNTETPAPSPTV
VRPKDRRVGAPSPGPFLRGSTIIRSKTFSPGPQSQYVCRLNRSDSDSSTLSKKPPFVRNS
LERRSVRMKRPSSVKSLRAERLIRTSLDLELDLQATRTWHSQLTQEISVLKELKEQLEQA
KSHGEKELPQWLREDDRFRLLLRMLEKRMDRGEHKGELQTDKMMRAAAKDVHRLRGQSCK
EPPEVQSFREKMAFFTQPRMNIPTLSADDV
Download sequence
Identical sequences M3YNQ5
ENSMPUP00000012962 ENSMPUP00000012962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]