SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013099 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013099
Domain Number 1 Region: 494-645
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.72e-67
Family Ankyrin repeat 0.0000000494
Further Details:      
 
Domain Number 2 Region: 3-222,255-280
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.21e-61
Family BAR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 372-490
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.14e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.000000744
Further Details:      
 
Domain Number 4 Region: 253-361
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-21
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 5 Region: 835-914
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-16
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013099   Gene: ENSMPUG00000013197   Transcript: ENSMPUT00000013310
Sequence length 916
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896914.1:6073103:6178304:1 gene:ENSMPUG00000013197 transcript:ENSMPUT00000013310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLYKMKKSVKAINVSGLAHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKEL
TALFKNLIQNMNNIISFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHA
KLHGMIRTEISGAEIAEEMEKERRLFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQC
NFFQDGLKAVESLKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVEQKEDSQLR
QSTAYSLHQPQGNKEHGTERNGNLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAK
LNLLTCQVKTNPEEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDD
NTGENNIVQELTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGV
HYSRMQSLTLDVLGTSELLLAKNIGNAGFNEIMECCLPAEDSVKPNPGSDMNARKDYITA
KYIERRYARKRHADNAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETA
LHLAVRSVDRTSLHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIE
TANESGETPLDIARRLRHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDVDEK
LQPSPSRREDRPVSFYQLGSGQLQSNAASLARDATSLAKDKQRSFVPSILQNETYGAVLS
GSPPPTQPVVPSTSSAPPLPPRNVAKDPLAPTPPPPVAKTPSVMEALSQQSKPAQPGIQL
SKAPPPPLPPQPPSRLPQKRPVPGADKSTPLMSKGQPRGPGVELSGPDALGAPSNAAALQ
PPAPMPRKSQTTKLKPKRVKALYNCVADNPDELTFSEGDVIIVDGEEDQEWWIGHIDGDP
SRKGAFPVSFVHFIAD
Download sequence
Identical sequences M3YP42
ENSMPUP00000013099 ENSMPUP00000013099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]