SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013112 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013112
Domain Number 1 Region: 57-193
Classification Level Classification E-value
Superfamily PH domain-like 0.0000148
Family Phosphotyrosine-binding domain (PTB) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013112   Gene: ENSMPUG00000013210   Transcript: ENSMPUT00000013323
Sequence length 200
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896914.1:6179738:6190059:-1 gene:ENSMPUG00000013210 transcript:ENSMPUT00000013323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNLDTC
AEFRIKYVGAIEKLKFSEGKSLEGPLDLINYIDVAQQDGKLPFVPLEEEFIMGVSKYGIK
VSSSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNKEYSLWVYQCSSLEQA
QAICKVLSTAFDSVLTSEKA
Download sequence
Identical sequences M3YP55
XP_012908354.1.14098 XP_012908355.1.14098 XP_012908356.1.14098 XP_012908357.1.14098 XP_012908358.1.14098 XP_012908359.1.14098 ENSMPUP00000013112 ENSMPUP00000013112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]