SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013131 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013131
Domain Number 1 Region: 153-262,308-579
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-149
Family Myotubularin-like phosphatases 0.0000000272
Further Details:      
 
Domain Number 2 Region: 1119-1204
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.74e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Domain Number 3 Region: 52-132
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000908
Family GRAM domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013131   Gene: ENSMPUG00000013229   Transcript: ENSMPUT00000013342
Sequence length 1211
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897019.1:2342474:2415807:-1 gene:ENSMPUG00000013229 transcript:ENSMPUT00000013342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEETRHSLECIQANQIFPRKQLIREDENLQVPFLELHGESTEYVGRAEDAIIALSNYRL
HIKFKESLVNVPLQLIESVECRDIFQLHLTCKDCKVIRCQFSTFEQCQEWLKRLNNAIRP
PAKIEDLFSFAYHAWCMEVYASEKEQHGDLCRPGEHVTSRFKNEVERMGFDMNNAWRISN
INEKYKLCGSYPQELIVPAWITDKELESVASFRSWKRIPAVVYRHQSNGAVIARCGQPEV
SWWGWRNADDEHLVQSVAKACASDSRSSGSKLSTRNSSRDFPNAGDLSDVEFDSSLSNAS
GADSLAIQPQKLLILDARSYAAAVANRAKGGGCECPEYYPNCEVVFMGMANIHSIRRSFQ
SLRLLCTQMPDPGNWLSALESTKWLHHLSVLLKSALLVVHAVDRDQRPVLAHCSDGWDRT
PQIVALAKLLLDPYYRTIEGFQVLVEMEWLDFGHKFADRCGHGENSDDLNERCPVFLQWL
DCVHQLQRQFPCSFEFNEAFLVKLVQHTYSCLFGTFLCNNAKERGEKHTQERTCSVWSLL
RAGNKAFKNLLYSSQSEAVLYPVCHVRNLMLWSAVYLPCPSPSTPVDDSCAPYPAPGTSP
DDPPLSRLPKTRSFDNLTTACDNTVPLASRRSSDPSLNEKWQEHRRSLELSSLAGPGEEP
LDPDSLGKPTKVLGGAELSVAAGVAEGQMENILQEATKEESGVEEPPHRGSVEMQEVEEE
AVLEKQIRAKTPEGSAIIFPQEPELGDAALVNCPDTGLSVFSQDIPEQQGRHSVLPSFLP
ESLEREDAQEVPMEQPQIGATTEGREEAFLPVPVDAKDGYGTSQSSSLLPSQVPFEARGP
NTDSSMDRLTEDQVKSESGPEGHHTPCLVNRGWFSDKHMLPQTMEPRPSGKSLAERPQVA
SVVHRTSPGSTHSPTHSPCALPLAECKEGLVCNGALETENKALEQPPGLSTLQKHATPNG
HCTNGEAGKSKDSLSRQLSATSCGSAHLHSRNLHHKWLHSHLGRPSTTGSPDQPSRSHLD
DDGMPVYTDTIQQRLRQIESGHQQEVETLKKQVQELRSRLESQYLTGSLRFNGDFGDEVT
SIPDSESNLDQNCLSRCSTEIFSEASWEQVDKQDTEMTRWLPDHLAAHCYACDSAFWLAS
RKHHCRDTDRVDQTWNCGNVFCSSCCNQKVPVPSQQLFEPSRVCKSCYSSLHPTSSSIDL
ELDKPIAATSN
Download sequence
Identical sequences M3YP74
XP_012918927.1.14098 ENSMPUP00000013131 ENSMPUP00000013131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]