SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013160 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013160
Domain Number 1 Region: 20-152
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.85e-43
Family Type II thymidine kinase 0.000000709
Further Details:      
 
Domain Number 2 Region: 152-197
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000038
Family Type II thymidine kinase zinc finger 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013160   Gene: ENSMPUG00000013258   Transcript: ENSMPUT00000013371
Sequence length 240
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896922.1:3569872:3580033:1 gene:ENSMPUG00000013258 transcript:ENSMPUT00000013371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVMSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQVAQYKCLVIKYAKD
TRYSSRFSTHDRNTMEALPASLLRDVAQEALGVAVIGIDEGQFFPDIVEFSETMANAGKT
VIVAALDGTFQRKAFGTILNLVPLAESVVKLTAVCMECFREAAYTKRLGSEKEVEVIGGA
DKYHSVCRLCYFKKPAGLPAAPDGKENKENCPVPVPARPAEAAGARKLFAPHQVLQCSPA
Download sequence
Identical sequences M3YPA3
ENSMPUP00000013160 ENSMPUP00000013160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]