SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013174 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013174
Domain Number 1 Region: 50-237
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.08e-52
Family Tpt1/KptA 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013174   Gene: ENSMPUG00000013272   Transcript: ENSMPUT00000013385
Sequence length 274
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897050.1:1771745:1774710:1 gene:ENSMPUG00000013272 transcript:ENSMPUT00000013385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGLLRLGRRGRCDASELDFAMNSRGGRRQETTGSRGRRAHRPRGQDQDVQLSKALSYVL
RHGALKLGLPMRADGFVPLGTLLQLPQFHGFSAEDVQRVVDTNEKQRFALQPGDPGTGPL
IRANQGHSLQVPELELMPLETPQALPLRLVHGTFWQHWPSILLNGLSCRGRTHIHLALGL
PGDPGVISGMRPNCEVAVFIDGPRALADGIPFFRSANGVILTPGNADGFLLPKYFKEALQ
LRPTRKSLSLAGNEETEYQSGPKHSSRGSRMTQQ
Download sequence
Identical sequences M3YPB6
ENSMPUP00000013174 XP_004770241.1.14098 ENSMPUP00000013174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]