SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013182 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013182
Domain Number 1 Region: 360-452
Classification Level Classification E-value
Superfamily PH domain-like 9.04e-19
Family Pleckstrin-homology domain (PH domain) 0.007
Further Details:      
 
Domain Number 2 Region: 550-638
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-18
Family Third domain of FERM 0.004
Further Details:      
 
Domain Number 3 Region: 250-301
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000667
Family Second domain of FERM 0.0073
Further Details:      
 
Domain Number 4 Region: 463-549
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000249
Family Second domain of FERM 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013182
Domain Number - Region: 16-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0583
Family Ubiquitin-related 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013182   Gene: ENSMPUG00000013280   Transcript: ENSMPUT00000013393
Sequence length 663
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897050.1:1774334:1791665:-1 gene:ENSMPUG00000013280 transcript:ENSMPUT00000013393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGMKTATGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEEIKRKQDWS
DHAIWWEQKKQWLLQTHWTLDKYGILADARLFFGPQHRPIILRLPNRRALRLRASFSQPL
FQAVAAICRLLSIRHPEELSLLRAPEKKEKKKKDKEPEEELYDLTKVVLAGGVAPALFRG
MPAHFSDSAQTEACYHMLSRPQPPPDPALLQRLPRPSSLLDKTQLHSRWLDSSRCLMQQG
ITAGDMLWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDVLLEETDCTEEEMMVFAALQYH
INKLSQSGEVGEPTGTDPGLDDLDAALNNLEVKLEGSAATDVLDNLTTIPELKDYLRIFR
PRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKFCIKL
LVPSPEGMSEVYLRCQDEKQYAHWMAGCRLASKGRTMADSSYPSEVQAILAFLSLQRTGG
GGSGGHPQGPDAAAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLSEAQLRFI
QAWQSLPDFGISYIVVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNW
DIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTGGH
EAF
Download sequence
Identical sequences M3YPC4
XP_004770238.1.14098 XP_012900110.1.14098 ENSMPUP00000013182 ENSMPUP00000013182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]