SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013206 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013206
Domain Number 1 Region: 66-236
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-35
Family Pleckstrin-homology domain (PH domain) 0.0000537
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013206   Gene: ENSMPUG00000013304   Transcript: ENSMPUT00000013417
Sequence length 1251
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896930.1:7881747:8016594:-1 gene:ENSMPUG00000013304 transcript:ENSMPUT00000013417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERWRCPPGDACPAALGGWRGPPRGACSHNQQTTAFRHPVSGQFSPENSEFILQEEPHPH
MSKQERNQRPSSMVSETSTAGTTSTVEAKPGPKIMKSSNKVHSFGKRDQAIRRNPNVPVV
VRGWLHKQDSSGMRLWKRRWFVLADYCLFYYKDSREEAVLGSIPLPSYVISPVAPEDRIS
RKYSFKAVHTGMRALIYNSSAGGSQAEQSGMRTYYFSADTQEDMNAWVRAMNQAAQVLSR
SSLKRDVEKVERQAVPQANHTESCRECGRVGPGHARDCPHRSHEDSFGFERREQEEERYR
SQRDPLESKRDRSKARSPYSPAEEDALFVDLPGGLRGQQAQPQRAEKNGVLPGMYGPGEQ
NGTGGYQRAFPPRNNTEKHSQRKSSLAQVEHWAKAQKGDGRSLPLDQTLPRQGPSQSLSF
PENYQTLPKSSRYPSGGSSPPPRDLPSDYKYAQDRASHLKMSSEERRAHRDGTVWQLYEW
QQRQQFRHGSPTAPICAGSPDFTDQGRSRSMLEVPRSISVPPSPSDIPPPGPPRVFPPRR
PHTPAERVTVKPPDQRRSVDISLGGSPRKARGHATKNSSHVDRRSMPSMGYVTHTVSAPS
LHGKSADDTYLQLKKDLEYLDLKMTGRDLVKDRSLKPVKIAESDIDVKLSIFCEQDRILQ
DLEDKIRALKENKDQLESVLEVLHRQMEQYRDQPQHLEKIAHQQRLLQEDLVHIRAEISR
ESTEMDNAWNEYLKLESDVQQLKQTLQEQHRRAFFFQEKSQIQKDLWRIEDVIAGLSANK
ENFRILVESVKNPERKTVPLFPHPPVPSLSTSESKPPPQLSPPTSPVRTPLEVRLFPQLQ
TYVPYRPHPPQLRKVTSPLQSPTKAKPKVEDEAPPRPPLPELYSPEDQPPAVPPLPKEAT
IIRHTSVRGLKRQSDERKRDREQGQCVNGDSRVELRSYVSEPELATFSGDTAQPSLGLVG
PDSRYQTLPGRGLSGSTSRLQQSSTIAPYVTLRRGLNAESSKVTFPRPKSALERLYSGDH
QRGQMSAEEQLERMKRHQKALVRERKRTLSQGERTGLPSSRYLSQPLPGDRGSWKREQDF
DLQLLERAMQGERKDKEENGWLKVQAMPVTELDLEPQDYDLDISRELAKPEKVSIPERYV
ELDPEEPPSLEELQARYRKAEKIRNILARSSMCNLQPPSGQDRNSAADLDLQLQEQERII
NISYALASEASQRSKQVAAQQLALFPPNAPLSSRTVPPYPPLSNGLHYTFV
Download sequence
Identical sequences M3YPE8
ENSMPUP00000013206 ENSMPUP00000013206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]