SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013220 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013220
Domain Number 1 Region: 238-425
Classification Level Classification E-value
Superfamily ADP-ribosylation 7.91e-46
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00038
Further Details:      
 
Domain Number 2 Region: 117-236
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 4.45e-22
Family Domain of poly(ADP-ribose) polymerase 0.0014
Further Details:      
 
Domain Number 3 Region: 735-888
Classification Level Classification E-value
Superfamily vWA-like 1.07e-18
Family Integrin A (or I) domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013220   Gene: ENSMPUG00000013318   Transcript: ENSMPUT00000013431
Sequence length 1556
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897167.1:781076:910987:1 gene:ENSMPUG00000013318 transcript:ENSMPUT00000013431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILIRHWTSYHFLVKRQAVLIGAEGGKEVAVVELQSSQYPRDPAFLISAHFLLANGLKTR
KFSVKKTSADASEYYENYIEELKKQSFLLREHFTPEATQLASEKLQALLLEEVINSSILS
KEVSDLVEMVWAEALGHLEHLLLKPVNRISLNDVSKAEGVLLLVKAALKNGETEEQLQKM
MTEFYRLIPHKGTTTEKVNLRLLAKKEDLCQLIRDMVNVCETNLFKPNPPSLAKYRALRC
KIEHVEQNTEEFFRVKEEVLQNNYSKGPVDILQIFRVGKVNETTEFLNKFGNVKSLLHGS
PVQSFVGILSRGLLLPKVVEDRGTKRTDIGNLGSGIYFSDSISTSTKYSHSGETDGTRLL
VVCDVALGKCMDLNKKDFSLSEAPPGYDSVHGVRATATVTTDFEDDEFVVYKTNQIKMKY
IIKFCIFGDEIKDFHPCNTTELEEYRPELSNFSNVEDYQLVDTKPSSNFNSGLQDVSGNS
VPLEDVHIKGKIIDFVAQVIVFQTYTNRSSVPIEARYIFPLDEKAAVCGFEAFINGKHIV
GEVKEKGAAHHEYREAITQGHGAYLMDQDASDVFTVSVGNLPPKAKVLIKVTYITELSIQ
GNRAVFFMPAAVAPWQQDKVLNENIQDTVEKIYIEKIGTKQSFSLSMSIEMPYGIESISS
DTHKLRQKCTDCKAVISTVEGSSLDTDGFSLHVGLSDAYLPRMWVEKHPEKESEACMLVF
QPDLSITVPDLAENNEVIICLDCSNSMEGATFLQAKQIALYALSLMGKKQKINIVKFGTG
YKELFSYPKSITSNNMPSEFIMSATPTMGNTDFWKTLRYLNLLYPSQGFRSILLISDGHL
QNESLTLQLVKRNVQHTRLFSCGIGSTANRHILRTLSQYGAGVFEYFNSKSKHSWKKQIE
DQMARLHSPSCHSVSIKWQQLSTDAPEPLQAPAQVQSLFHNERLLVYGFIPHCTQATLCA
LIQEKEFSTVVSTSELQKTTGTMIHKLTARALIRDYEDGILHENETNHEMKKQILKSLII
KLSKENCLITQFTSFVAVEKRDGKELPSPNIPNIWELIAKEDVDFLPYMSWQEEQPDTSV
AQPLLAFFEWNEELQQPHLTNRKFRSYHLEDSEDSEDFEDSSQLSEKPLTLNFECEDVEK
PLDLSQMDSFKQPLCRDTPIPKLVSCSISAAHGSALLGDEPFEVACFLHHPHLHPKIFAR
SLKEFGPSKYDQDLQADHLSDITPASHTPYRLPPPRLKSFGFCAREGVSFNTSDANLPET
YQGHKTDNSANIFSELDSPPQPNIDLPPRRLNSAGPSRGFAFHSLSCSPLYFQNSAVPFS
TSYKPPADLFANTELEASFCTALSAGTSLSPSSNGSFSETENNGTPEFLANYFLQEVTIS
EKKKEKKKKQEVIISDITRSDFIASFQAQKNEQSWMNIVPWTELFSLQTEDGFWKLTPEL
GFILNLNTIILNSFLEQKGIRSLGIKGRERLLELIATFLVLQFLRTKLEQKGIVFKSLMK
LDDASISRNIPWAFEEIKKASEWVRRTEGQYPSICQRLELGQDWDSATKQLLGIQT
Download sequence
Identical sequences M3YPG2
ENSMPUP00000013220 ENSMPUP00000013220 XP_012904272.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]